6FSU: Outer membrane protein assembly factor BamA

Name: PDB 6FSU: Crystal structure of E.coli BamA beta-barrel with a C-terminal extension
Published: 2018-11-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Crystal structure of E.coli BamA beta-barrel with a C-terminal extension. Determined by X-ray diffraction at 2.6 Å resolution. Released 14 Nov 2018.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Escherichia coli O157:H7
Chains: 2
Atoms: 6,195
Mol. weight: 94.06 kDa
Released: 14 Nov 2018

Explore 6FSU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FSU contains 15 α-helices and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	414-420	7
β-strand	423-433	11	1
β-strand	437-446	10	1
β-strand	455-462	8	1
β-strand	466-475	10	1
β-strand	484-495	12	1
α-helix	496-499	4
β-strand	501	1	2
β-strand	505-520	16	1
β-strand	523-537	15	1
β-strand	542	1	3
α-helix	543-551	9
β-strand	564-579	16	1
β-strand	590-600	11	1
β-strand	608-620	13	1
β-strand	628-640	13	1
α-helix	644-647	4
α-helix	648-650	3
β-strand	652	1	4
β-strand	662-663	2	5
β-strand	671	1	2
β-strand	674	1	3
α-helix	675-676	2
β-strand	700	1	3
β-strand	705	1	2
β-strand	708	1	4
β-strand	710-720	11	1
α-helix	721-722	2
α-helix	730-732	3
β-strand	733-745	13	1
β-strand	767-778	12	1
β-strand	781-792	12	1
β-strand	799-800	2	5
β-strand	802-815	14	1

Chain B: 7 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	414-420	7
β-strand	423-433	11	6
β-strand	437-446	10	6
β-strand	455-462	8	6
β-strand	466-475	10	6
β-strand	484-495	12	6
α-helix	496-499	4
β-strand	501	1	7
β-strand	505-520	16	6
β-strand	523-537	15	6
β-strand	542	1	8
α-helix	543-551	9
β-strand	565-579	15	6
β-strand	590-600	11	6
β-strand	608-620	13	6
β-strand	628-640	13	6
α-helix	644-647	4
α-helix	648-650	3
β-strand	652	1	9
β-strand	662-663	2	10
β-strand	671	1	7
β-strand	674	1	8
α-helix	675-676	2
β-strand	700	1	8
β-strand	705	1	7
β-strand	708	1	9
β-strand	710-720	11	6
α-helix	721-722	2
β-strand	730	1	11
β-strand	733	1	11
β-strand	734-745	12	6
β-strand	767-775	9	6
β-strand	778	1	12
β-strand	781	1	12
β-strand	783-792	10	6
β-strand	799-800	2	10
β-strand	802-815	14	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer membrane protein assembly factor BamA	A, B	protein	420	Escherichia coli O157:H7	P0A940 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6FSU_1 Outer membrane protein assembly factor BamA (chains A, B)
MGSSHHHHHHSSGENLYFQHMRNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGIN
GTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPI
NEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYN
KLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGD
GLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYESATQDGAKDL
SKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPD
YSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTWMENVALDFS

Primary citation

Sequence-Specific Solution NMR Assignments of the beta-Barrel Insertase BamA to Monitor Its Conformational Ensemble at the Atomic Level. Hartmann, J.B., Zahn, M., Burmann, I.M. et al. J Am Chem Soc (2018) 140:11252-11260. DOI 10.1021/jacs.8b03220 · PubMed

Other PDB entries of the same protein (UniProt P0A940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q6B 1.5 Å, The high-resolution and new form crystal structure of BamA POTRA4-5 from E.coli
9CS2 1.78 Å, E. coli BamA beta-barrel bound to cyclic peptide CP3
6QGW 1.94 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody E6
9CS0 1.94 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP1
9CS1 2.15 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP2
4XGA 2.15 Å, Crystal structure of BamB and BamA P3-5 complex from E.coli
2QDF 2.2 Å, Structure of N-terminal domain of E. Coli YaeT
6QGX 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody F7
7NRF 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 2)
7NRE 2.3 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 1)
7P1C 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin B
7R1V 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with dynobactin A

Browse structure collections

About this viewer

MolViewer shows 6FSU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.