6JJZ: MAGI2 and Dendrin complex

Crystal Structure of MAGI2 and Dendrin complex. Determined by X-ray diffraction at 1.65 Å resolution. Released 25 Sept 2019.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Mus musculus
Chains: 4
Atoms: 1,850
Mol. weight: 28.08 kDa
Released: 25 Sept 2019

Explore 6JJZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6JJZ contains 12 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	302-304	3
β-strand	307-311	5	1
β-strand	317-321	5	1
β-strand	326-328	3	1
α-helix	332-334	3
α-helix	341-343	3
β-strand	353-358	6	2
β-strand	362-367	6	2
β-strand	372-374	3	2
α-helix	378-386	9

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	299-304	6
β-strand	307-311	5	3
β-strand	317-321	5	3
β-strand	326-328	3	3
α-helix	332-334	3
α-helix	341-343	3
β-strand	353-358	6	4
β-strand	362-367	6	4
β-strand	372-374	3	4
α-helix	378-386	9

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	225-227	3
α-helix	229-233	5

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	224-227	4
α-helix	231-233	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2	A, B	protein	102	Mus musculus	Q9WVQ1 (AlphaFold model)
Peptide from Dendrin	C, D	protein	18	Mus musculus	Q80TS7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6JJZ_1 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 (chains A, B)
GPGSEFEENEDSDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENE
LPYGWEKIDDPIYGTYYVDHINRRTQFENPVLEAKRKLQQHN

Sequence of entity 2 (C, D), FASTA

>6JJZ_2 Peptide from Dendrin (chains C, D)
GPGSDRPPPYVAPPSYEG

Primary citation

Decoding WW domain tandem-mediated target recognitions in tissue growth and cell polarity. Lin, Z., Yang, Z., Xie, R. et al. Elife (2019) 8. DOI 10.7554/eLife.49439 · PubMed

Other PDB entries of the same protein (UniProt Q9WVQ1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7YKI 2.0 Å, Crystal structure of MAGI2 PDZ0-GK domain in complex with phospho-SAPAP1 GBR3 peptide
6KKG 2.15 Å, Crystal structure of MAGI2-Dendrin complex
7YKG 2.16 Å, Crystal structure of MAGI2 PDZ0-GK/pSGEF complex
7YKF 2.28 Å, Crystal structure of MAGI2 PDZ0-GK/pEphexin4 complex
7YKH 2.5 Å, Crystal structure of MAGI2 PDZ0-GK domain in complex with phospho-SAPAP1 GBR2 peptide
7D6F 3.0 Å, The crystal structure of ARMS-PBM/MAGI2-PDZ4

Browse structure collections

About this viewer

MolViewer shows 6JJZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.