6KKG: MAGI2-Dendrin complex

Crystal structure of MAGI2-Dendrin complex. Determined by X-ray diffraction at 2.15 Å resolution. Released 29 Jul 2020.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Mus musculus
Chains: 4
Atoms: 1,917
Mol. weight: 28.64 kDa
Released: 29 Jul 2020

Explore 6KKG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KKG contains 13 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	302-304	3
β-strand	307-311	5	1
β-strand	317-321	5	1
β-strand	326-328	3	1
α-helix	332-334	3
α-helix	336	1
β-strand	337	1	2
α-helix	338	1
α-helix	341-343	3
β-strand	353-358	6	3
β-strand	362-367	6	3
β-strand	372-374	3	3
α-helix	378-385	8

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	302-304	3
β-strand	307-311	5	4
β-strand	317-321	5	4
β-strand	326-328	3	4
α-helix	332-334	3
β-strand	337	1	2
α-helix	341-343	3
β-strand	353-358	6	5
β-strand	362-367	6	5
β-strand	372-374	3	5
α-helix	378-385	8

Chain C: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	224-227	4
α-helix	229-232	4
β-strand	238	1	1

Chain D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	224-227	4
β-strand	238	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2	A, B	protein	100	Mus musculus	Q9WVQ1 (AlphaFold model)
Peptide from Dendrin	C, D	protein	24	Mus musculus	Q80TS7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6KKG_1 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 (chains A, B)
GPGSEENEDSDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELP
YGWEKIDDPIYGTYYVDHINRRTQFENPVLEAKRKLQQHN

Sequence of entity 2 (C, D), FASTA

>6KKG_2 Peptide from Dendrin (chains C, D)
GPGSDRPPPYVAPPSYEGPHRTLG

Primary citation

Phase separation of MAGI2-mediated complex underlies formation of slit diaphragm complex in glomerular filtration barrier. Zhang, H.J., Lin, L., Lin, Z.J. et al. To be published.

Other PDB entries of the same protein (UniProt Q9WVQ1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JJZ 1.65 Å, Crystal Structure of MAGI2 and Dendrin complex
7YKI 2.0 Å, Crystal structure of MAGI2 PDZ0-GK domain in complex with phospho-SAPAP1 GBR3 peptide
7YKG 2.16 Å, Crystal structure of MAGI2 PDZ0-GK/pSGEF complex
7YKF 2.28 Å, Crystal structure of MAGI2 PDZ0-GK/pEphexin4 complex
7YKH 2.5 Å, Crystal structure of MAGI2 PDZ0-GK domain in complex with phospho-SAPAP1 GBR2 peptide
7D6F 3.0 Å, The crystal structure of ARMS-PBM/MAGI2-PDZ4

Browse structure collections

About this viewer

MolViewer shows 6KKG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.