6KZJ: Ankyrin B/NdeL1 complex

Crystal structure of Ankyrin B/NdeL1 complex. Determined by X-ray diffraction at 1.5 Å resolution. Released 15 Jan 2020.

Method: X-ray diffraction
Resolution: 1.5 Å
Organisms: Homo sapiens, Mus musculus
Chains: 3
Atoms: 1,172
Mol. weight: 18.71 kDa
Released: 15 Jan 2020

Explore 6KZJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KZJ contains 9 α-helices and 2 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	1501-1521	21
α-helix	1534-1543	10
α-helix	1548-1568	21

Chain B: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	239-240	2
β-strand	241	1	1
α-helix	242	1
α-helix	243-269	27

Chain C: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	239-240	2
β-strand	241	1	1
α-helix	242	1
α-helix	243-275	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ankyrin-2	A	protein	76	Homo sapiens	Q01484 (AlphaFold model)
Nuclear distribution protein nudE-like 1	B, C	protein	51	Mus musculus	Q9ERR1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6KZJ_1 Ankyrin-2 (chains A)
GPGSASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVER
VKEDLEKVNEILRSGT

Sequence of entity 2 (B, C), FASTA

>6KZJ_2 Nuclear distribution protein nudE-like 1 (chains B, C)
GPGSGFGTSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQASRK

Primary citation

Mechanistic insights into the interactions of dynein regulator Ndel1 with neuronal ankyrins and implications in polarity maintenance. Ye, J., Li, J., Ye, F. et al. Proc Natl Acad Sci U S A (2020) 117:1207-1215. DOI 10.1073/pnas.1916987117 · PubMed

Other PDB entries of the same protein (UniProt Q01484 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5Y4F 1.95 Å, Crystal Structure of AnkB Ankyrin Repeats R13-24 in complex with autoinhibition segment…
8ZE8 2.07 Å, Arf-GTPase activating protein Asap1 SH3 domain in complex with 440 Kd Ankyrin-B fragment
5YIS 2.2 Å, Crystal Structure of AnkB LIR/LC3B complex
4D8O 2.2 Å, Crystal Structure of the ankyrin-B ZU5-ZU5-UPA-DD tandem
5Y4E 2.34 Å, Crystal Structure of AnkB Ankyrin Repeats R8-14 in complex with autoinhibition segment…
4RLY 2.5 Å, Crystal Structure of AnkB Ankyrin Repeats (R1-R9) in Complex with Nav1.2 Ankyrin Binding…
5YIR 2.75 Å, Crystal Structure of AnkB LIR/GABARAP complex
5Y4D 3.3 Å, Crystal Structure of AnkB Ankyrin Repeats in Complex with AnkR/AnkB Chimeric…
6M3Q 3.44 Å, Crystal structure of AnkB/beta4-spectrin complex
4RLV 3.49 Å, Crystal Structure of AnkB 24 Ankyrin Repeats in Complex with AnkR Autoinhibition Segment

Browse structure collections

About this viewer

MolViewer shows 6KZJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.