6LOG: Human CCL5-12AAA14 mutant

Crystal structure of human CCL5-12AAA14 mutant. Determined by X-ray diffraction at 2.55 Å resolution. Released 18 Mar 2020.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Homo sapiens
Chains: 1
Atoms: 508
Mol. weight: 7.83 kDa
Released: 18 Mar 2020

Explore 6LOG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LOG contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
α-helix	18-20	3
α-helix	21-23	3
β-strand	24-29	6	1
β-strand	39-43	5	1
β-strand	48-51	4	1
α-helix	56-66	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C motif chemokine 5	A	protein	69	Homo sapiens	P13501 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6LOG_1 C-C motif chemokine 5 (chains A)
MSPYSSDTTPCCAAAIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVR
EYINSLEMS

Primary citation

N-terminal Backbone Pairing Shifts in CCL5- 12 AAA 14 Dimer Interface: Structural Significance of the FAY Sequence. Li, J.Y., Chen, Y.C., Lee, Y.Z. et al. Int J Mol Sci (2020) 21. DOI 10.3390/ijms21051689 · PubMed

Other PDB entries of the same protein (UniProt P13501 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5COY 1.44 Å, Crystal structure of CC chemokine 5 (CCL5)
6STK 1.52 Å, Crystal structure of the CC-chemokine 5 (CCL5) E66S mutation
1B3A 1.6 Å, Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV…
1EQT 1.6 Å, Met-rantes
6AEZ 1.63 Å, Crystal structure of human CCL5 trimer
1U4P 1.7 Å, Crystal Structure of human RANTES mutant K45E
2VXW 1.7 Å, Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-RANTES
1U4L 2.0 Å, human RANTES complexed to heparin-derived disaccharide I-S
1U4M 2.0 Å, human RANTES complexed to heparin-derived disaccharide III-S
1U4R 2.2 Å, Crystal Structure of human RANTES mutant 44-AANA-47
5UIW 2.2 Å, Crystal Structure of CC Chemokine Receptor 5 (CCR5) in complex with high potency HIV…
5L2U 2.28 Å, Oligomer crystal structure of CC chemokine 5 (CCL5)

Browse structure collections

About this viewer

MolViewer shows 6LOG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.