6P7J: Latency Associated Peptide unbound to TGF-beta1

Crystal structure of Latency Associated Peptide unbound to TGF-beta1. Determined by X-ray diffraction at 3.5 Å resolution. Released 11 Mar 2020.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,298
Mol. weight: 29.27 kDa
Released: 11 Mar 2020

Explore 6P7J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6P7J contains 2 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	79-84	6	1
β-strand	103-106	4	2
α-helix	108-110	3
β-strand	120-129	10	1
β-strand	136-143	8	2
β-strand	149-157	9	2
β-strand	164-169	6	1
α-helix	171-179	9
β-strand	185-191	7	2
β-strand	193-198	6	3
β-strand	201-206	6	3
β-strand	218	1	1
β-strand	227-232	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transforming growth factor beta-1 proprotein	A	protein	255	Homo sapiens	P01137 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6P7J_1 Transforming growth factor beta-1 proprotein (chains A)
LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVA
GESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVL
LSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLS
RGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQ
HLQSSRHRAHHHHHH

Primary citation

Structural insights into conformational switching in latency-associated peptide between transforming growth factor beta-1 bound and unbound states. Stachowski, T.R., Snell, M.E., Snell, E.H. IUCrJ (2020) 7:238-252. DOI 10.1107/S205225251901707X

Other PDB entries of the same protein (UniProt P01137 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UDZ 2.21 Å, The Structure of LTBP-49247 Fab Bound to TGFbeta1 Small Latent Complex
9VJJ 2.48 Å, Crystal Structure of human Latent TGF-beta1 in complex with SOF10
8C7H 2.7 Å, Cryo-EM Map of the latTGF-beta LHG-10 Fab complex
13FJ 2.75 Å, TGFB1 in complex with NIS793 FAB
6OM2 2.77 Å, Crystal structure of atypical integrin alphaV beta8 with proTGF-beta1 ligand peptide
5VQP 2.9 Å, Crystal structure of human pro-TGF-beta1
8REW 2.98 Å, CryoEM structure of human GARP-lTGFbeta1 in complex with a Fab fragment derived from an…
3KFD 3.0 Å, Ternary complex of TGF-b1 reveals isoform-specific ligand recognition and receptor…
4KV5 3.0 Å, scFv GC1009 in complex with TGF-beta1.
8VSC 3.0 Å, L-tgf-b1/GARP
9R3S 3.06 Å, pro-TGF-beta1 in complex with the third TB Domain from Latent Transforming Growth…
6GFF 3.1 Å, Structure of GARP (LRRC32) in complex with latent TGF-beta1 and MHG-8 Fab

Browse structure collections

About this viewer

MolViewer shows 6P7J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.