Human Sun2-KASH3 complex. Determined by X-ray diffraction at 1.53 Å resolution. Released 2 Dec 2020.
Explore 6WME in 3D Show helices and sheets RCSB PDB PDBe
6WME contains 8 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 525-540 | 16 | |
| α-helix | 552-554 | 3 | |
| β-strand | 557-558 | 2 | 1 |
| α-helix | 560-562 | 3 | |
| α-helix | 564-565 | 2 | |
| β-strand | 566 | 1 | 2 |
| β-strand | 572-576 | 5 | 3 |
| β-strand | 579-583 | 5 | 3 |
| α-helix | 588-592 | 5 | |
| β-strand | 602-605 | 4 | 2 |
| β-strand | 609-627 | 19 | 1 |
| α-helix | 631-633 | 3 | |
| α-helix | 635-637 | 3 | |
| β-strand | 643 | 1 | 4 |
| β-strand | 645-651 | 7 | 1 |
| β-strand | 660-666 | 7 | 1 |
| β-strand | 674-678 | 5 | 1 |
| β-strand | 687-694 | 8 | 1 |
| β-strand | 697 | 1 | 4 |
| β-strand | 703-706 | 4 | 2 |
| β-strand | 708-715 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 966-969 | 4 | 3 |
| α-helix | 972-974 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SUN domain-containing protein 2 | A | protein | 202 | Homo sapiens | Q9UH99 (AlphaFold model) |
| Nesprin-3 | B | protein | 34 | Homo sapiens | Q6ZMZ3 (AlphaFold model) |
>6WME_1 SUN domain-containing protein 2 (chains A) GPGGSGGVTEEQVHHIVKDALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALIS LFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSP NSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPGRGTYQVVELRIL TNWGHPEYTCIYRFRVHGEPAH
>6WME_2 Nesprin-3 (chains B) GPGGSGEEDRSCTLANNFARSFTLMLRYNGPPPT
Structural Analysis of Different LINC Complexes Reveals Distinct Binding Modes. Cruz, V.E., Esra Demircioglu, F., Schwartz, T.U. J Mol Biol (2020) 432:6028-6041. DOI 10.1016/j.jmb.2020.09.019 · PubMed
Other PDB entries of the same protein (UniProt Q9UH99 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6WME directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.