6YLS: PDB entry 6YLS

Name: PDB 6YLS: mEos4b - Directionality of Optical Properties of Fluorescent Proteins
Published: 2020-12-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

mEos4b - Directionality of Optical Properties of Fluorescent Proteins. Determined by X-ray diffraction at 1.55 Å resolution. Released 16 Dec 2020.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Lobophyllia hemprichii
Chains: 1
Atoms: 2,002
Mol. weight: 26.95 kDa
Released: 16 Dec 2020

Explore 6YLS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6YLS contains 7 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	10-20	11	1
β-strand	23-34	12	1
α-helix	35-37	3
β-strand	39-48	10	1
α-helix	50	1
α-helix	52	1
α-helix	56-62	7
β-strand	70	1	1
α-helix	78-81	4
β-strand	87-95	9	1
β-strand	100-110	11	1
β-strand	113-123	11	1
β-strand	136-139	4	1
α-helix	140-141	2
β-strand	142-149	8	1
β-strand	152-163	12	1
β-strand	167-179	13	1
α-helix	184-188	5
β-strand	190-201	12	1
β-strand	207-217	11	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Green to red photoconvertible GFP-like protein EosFP	A	protein	233	Lobophyllia hemprichii	Q5S6Z9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6YLS_1 Green to red photoconvertible GFP-like protein EosFP (chains A)
MVSAIKPDMRIKLRMEGNVNGHHFVIDGDGTGKPYEGKQTMDLEVKEGGPLPFAFDILTT
AFHYGNRVFVKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVR
FYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIEMALLLEGNAHYRCDFRTTYKA
KEKGVKLPGAHFVDHAIEILSHDKDYNKVKLYEHAVAHSGLPDNARRGSHHHHHH

Primary citation

Directionality of light absorption and emission in representative fluorescent proteins. Myskova, J., Rybakova, O., Brynda, J. et al. Proc Natl Acad Sci U S A (2020) 117:32395-32401. DOI 10.1073/pnas.2017379117 · PubMed

Other PDB entries of the same protein (UniProt Q5S6Z9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QLJ 1.02 Å, Trans structure of rsKiiro Illuminated at 290 K
7QLI 1.16 Å, Cis structure of rsKiiro at 290 K
7QLM 1.3 Å, rsKiiro trans chromophore dark structure by SFX
7QLO 1.31 Å, rsKiiro pump dump probe structure by TR-SFX
7QLL 1.32 Å, rsKiiro Thermal annealing at 290K of 200K Cis intermediate
9J0Q 1.34 Å, Structure of mEos3.2 in the green fluorescent state
7QLK 1.46 Å, Cis structure intermediate of rsKiiro Illuminated at 200 K
6GP0 1.5 Å, Structure of mEos4b in the red fluorescent state
7QLN 1.5 Å, rsKiiro pump probe structure by TR-SFX
6GP1 1.5 Å, Structure of mEos4b in the red long-lived dark state
5OQ9 1.51 Å, XFEL structure of the off state of a reversibly photoswitching fluorescent protein…
5OQA 1.53 Å, XFEL structure of the off state of a reversibly photoswitching fluorescent protein…

Browse structure collections

About this viewer

MolViewer shows 6YLS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.