6Z66: Apo-state neurotensin receptor 1

Crystal structure of apo-state neurotensin receptor 1. Determined by X-ray diffraction at 3.19 Å resolution. Released 10 Feb 2021.

Method: X-ray diffraction
Resolution: 3.19 Å
Organisms: Rattus norvegicus, synthetic construct
Chains: 1
Atoms: 3,241
Mol. weight: 53.09 kDa
Released: 10 Feb 2021

Explore 6Z66 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Z66 contains 24 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 24 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	61-91	31
α-helix	98-100	3
α-helix	101-115	15
α-helix	116-120	5
α-helix	121-124	4
α-helix	125-130	6
α-helix	138-172	35
α-helix	174-180	7
α-helix	183-201	19
α-helix	203-207	5
β-strand	208-212	5	1
β-strand	223-227	5	1
α-helix	231-242	12
α-helix	243-247	5
α-helix	248-270	23
α-helix	298-333	36
α-helix	343-391	49
α-helix	394-403	10
α-helix	417-424	8
α-helix	427-436	10
α-helix	450-457	8
α-helix	460-469	10
α-helix	483-489	7
α-helix	493-502	10
α-helix	516-523	8
α-helix	526-543	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurotensin receptor type 1,Neurotensin receptor type 1,DARPin	AAA	protein	482	Rattus norvegicus, synthetic construct	P20789 (AlphaFold model)

Sequence of entity 1 (AAA), FASTA

>6Z66_1 Neurotensin receptor type 1,Neurotensin receptor type 1,DARPin (chains AAA)
GPGSGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNGVTLFTLARKKSLQSLQSRVDYY
LGSLALSDLLILLFALPVDLYNFIWVHHPWAFGDAGCKGYYFLREACTYATALNVVSLSV
ELYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNLSGDGTHPGGLVC
TPIVDTATLRVVIQLNTFMSFLFPMLVASILNTVAARRLTVMVHQAAFNMTIEPGRVQAL
RRGVLVLRAVVIAFVVCWLPYHVRRLMFVYISDEQWTTALFDFYHYFYMLSNALVYVSAA
INPILYNLAEDLVEDWEKARKLLEAARKGQDDEVRILLANGADVNTADETGFTPLHLAAW
EGHLGIVEVLLKNGADVNANDERGHTPLHLAAYTGHLEIVEVLLKNGAGVNATDVIGTAP
LHLAAMWGHLEIVEVLLKNGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAATRELEVL
FQ

Primary citation

Complexes of the neurotensin receptor 1 with small-molecule ligands reveal structural determinants of full, partial, and inverse agonism. Deluigi, M., Klipp, A., Klenk, C. et al. Sci Adv (2021) 7. DOI 10.1126/sciadv.abe5504 · PubMed

Other PDB entries of the same protein (UniProt P20789 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YVR 2.46 Å, Crystal structure of the neurotensin receptor 1 in complex with the peptide full agonist…
8FMZ 2.59 Å, Neurotensin receptor allosterism revealed in complex with a biased allosteric modulator
6Z4V 2.6 Å, Crystal structure of the neurotensin receptor 1 (NTSR1-H4bmx) in complex with NTS8-13
4XES 2.6 Å, Structure of active-like neurotensin receptor
6ZIN 2.64 Å, Crystal structure of the neurotensin receptor 1 in complex with the small molecule…
6Z4S 2.71 Å, Crystal structure of the neurotensin receptor 1 (NTSR1-H4bmx) in complex with the small…
6ZA8 2.72 Å, Crystal structure of the neurotensin receptor 1 in complex with the small-molecule…
4BUO 2.75 Å, High Resolution Structure of Thermostable Agonist-bound Neurotensin Receptor 1 Mutant…
4GRV 2.8 Å, The crystal structure of the neurotensin receptor NTS1 in complex with neurotensin (8-13)
6Z8N 2.8 Å, Crystal structure of the neurotensin receptor 1 in complex with the small-molecule full…
8FN1 2.88 Å, CryoEM structure of Go-coupled NTSR1
8FN0 2.89 Å, CryoEM structure of Go-coupled NTSR1 with a biased allosteric modulator

Browse structure collections

About this viewer

MolViewer shows 6Z66 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.