6Z8N: Neurotensin receptor 1

Crystal structure of the neurotensin receptor 1 in complex with the small-molecule full agonist SRI-9829. Determined by X-ray diffraction at 2.8 Å resolution. Released 10 Feb 2021.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Rattus norvegicus, synthetic construct
Chains: 1
Atoms: 3,335
Mol. weight: 53.55 kDa
Ligands: SR9
Released: 10 Feb 2021

Explore 6Z8N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Z8N contains 25 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 25 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	61-92	32
α-helix	97-115	19
α-helix	116-120	5
α-helix	121-124	4
α-helix	125-129	5
α-helix	134-135	2
α-helix	138-172	35
α-helix	174-180	7
α-helix	183-201	19
α-helix	203-207	5
β-strand	208-212	5	1
β-strand	223-227	5	1
α-helix	231-242	12
α-helix	243-247	5
α-helix	248-271	24
β-strand	297	1	2
α-helix	298-333	36
α-helix	341-363	23
α-helix	365-391	27
α-helix	394-402	9
β-strand	410	1	2
α-helix	417-424	8
α-helix	427-435	9
α-helix	450-457	8
α-helix	460-468	9
α-helix	483-490	8
α-helix	493-501	9
α-helix	516-523	8
α-helix	526-543	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurotensin receptor type 1,Neurotensin receptor type 1,Neurotensin receptor type 1,Neurotensin…	AAA	protein	482	Rattus norvegicus, synthetic construct	P20789 (AlphaFold model)

Sequence of entity 1 (AAA), FASTA

>6Z8N_1 Neurotensin receptor type 1,Neurotensin receptor type 1,Neurotensin receptor type 1,Neurotensin receptor type 1,Neurotensin receptor 1 (NTSR1),Neurotensin receptor 1 (NTSR1) (chains AAA)
GPGSGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNGVTLFTLARKKSLQSLQSRVDYY
LGSLALSDLLILLFALPVDLYNFIWVHHPWAFGDAGCKGYYFLREACTYATALNVVSLSV
ELYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNLSGDGTHPGGLVC
TPIVDTATLRVVIQLNTFMSFLFPMLVASILNTVAARRLTVMVHQAAFNMTIEPGRVQAL
RRGVLVLRAVVIAFVVCWLPYHVRRLMFVYISDEQWTTALFDFYHYFYMLSNALVYVSAA
INPILYNLAEDLVEDWEKARKLLEAARKGQDDEVRILLANGADVNTADETGFTPLHLAAW
EGHLGIVEVLLKNGADVNANDERGHTPLHLAAYTGHLEIVEVLLKNGAGVNATDVIGTAP
LHLAAMWGHLEIVEVLLKNGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAATRELEVL
FQ

Ligands and cofactors

ID	Name	Formula	Copies
SR9	(2~{S})-4-methyl-2-[(1-quinolin-8-ylsulfonylindol-3-yl)carbonylamino]pentanoic…	C24 H23 N3 O5 S	1

Primary citation

Complexes of the neurotensin receptor 1 with small-molecule ligands reveal structural determinants of full, partial, and inverse agonism. Deluigi, M., Klipp, A., Klenk, C. et al. Sci Adv (2021) 7. DOI 10.1126/sciadv.abe5504 · PubMed

Other PDB entries of the same protein (UniProt P20789 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YVR 2.46 Å, Crystal structure of the neurotensin receptor 1 in complex with the peptide full agonist…
8FMZ 2.59 Å, Neurotensin receptor allosterism revealed in complex with a biased allosteric modulator
6Z4V 2.6 Å, Crystal structure of the neurotensin receptor 1 (NTSR1-H4bmx) in complex with NTS8-13
4XES 2.6 Å, Structure of active-like neurotensin receptor
6ZIN 2.64 Å, Crystal structure of the neurotensin receptor 1 in complex with the small molecule…
6Z4S 2.71 Å, Crystal structure of the neurotensin receptor 1 (NTSR1-H4bmx) in complex with the small…
6ZA8 2.72 Å, Crystal structure of the neurotensin receptor 1 in complex with the small-molecule…
4BUO 2.75 Å, High Resolution Structure of Thermostable Agonist-bound Neurotensin Receptor 1 Mutant…
4GRV 2.8 Å, The crystal structure of the neurotensin receptor NTS1 in complex with neurotensin (8-13)
8FN1 2.88 Å, CryoEM structure of Go-coupled NTSR1
8FN0 2.89 Å, CryoEM structure of Go-coupled NTSR1 with a biased allosteric modulator
4XEE 2.9 Å, Structure of active-like neurotensin receptor

Browse structure collections

About this viewer

MolViewer shows 6Z8N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.