Crystal Structure of Stabilized Active Plasminogen Activator Inhibitor-1 (PAI-1-W175F) in Complex with an Inhibitory Nanobody (VHH-s-a93, Nb93). Determined by X-ray diffraction at 1.88 Å resolution. Released 26 Aug 2020.
Explore 6ZRV in 3D Show helices and sheets RCSB PDB PDBe
6ZRV contains 18 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-25 | 18 | |
| β-strand | 32-34 | 3 | 1 |
| α-helix | 36-49 | 14 | |
| α-helix | 52-62 | 11 | |
| α-helix | 71-82 | 12 | |
| β-strand | 91-100 | 10 | 2 |
| α-helix | 104-106 | 3 | |
| α-helix | 109-117 | 9 | |
| α-helix | 121 | 1 | |
| β-strand | 122-124 | 3 | 2 |
| α-helix | 129-142 | 14 | |
| β-strand | 163-171 | 9 | 2 |
| α-helix | 173-174 | 2 | |
| β-strand | 175 | 1 | 3 |
| α-helix | 178-180 | 3 | |
| α-helix | 181-183 | 3 | |
| β-strand | 185-190 | 6 | 1 |
| β-strand | 196-214 | 19 | 1 |
| β-strand | 220-227 | 8 | 1 |
| β-strand | 228 | 1 | 3 |
| β-strand | 233-240 | 8 | 1 |
| α-helix | 248-251 | 4 | |
| α-helix | 256-265 | 10 | |
| β-strand | 267-276 | 10 | 1 |
| β-strand | 278-285 | 8 | 2 |
| α-helix | 287-292 | 6 | |
| α-helix | 297-299 | 3 | |
| β-strand | 319-328 | 10 | 2 |
| α-helix | 340-341 | 2 | |
| β-strand | 342 | 1 | 4 |
| α-helix | 345-347 | 3 | |
| β-strand | 351-353 | 3 | 1 |
| β-strand | 358-364 | 7 | 1 |
| β-strand | 369-376 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 5 |
| β-strand | 10-12 | 3 | 4 |
| β-strand | 18-24 | 7 | 5 |
| β-strand | 32-39 | 8 | 4 |
| β-strand | 46-51 | 6 | 4 |
| β-strand | 58-60 | 3 | 4 |
| β-strand | 68-73 | 6 | 5 |
| β-strand | 78-83 | 6 | 5 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-100 | 9 | 4 |
| β-strand | 112-113 | 2 | 4 |
| β-strand | 117-121 | 5 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Plasminogen activator inhibitor 1 | A | protein | 379 | Homo sapiens | P05121 (AlphaFold model) |
| VHH-s-a93 (Nb93) | B | protein | 123 | Vicugna pacos |
>6ZRV_1 Plasminogen activator inhibitor 1 (chains A) VHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQA AMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRST VKQVDFSEVERARFIINDWVKTHTKGMISNLLGKGAVDQLTRLVLVNALYFNGQFKTPFP DSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAP YEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFR QFQADFTSLSDQEPLHVAQALQKVKIEVNESGTVASSSTAVIVSARMAPEEIIMDRPFLF VVRHNPTGTVLFMGQVMEP
>6ZRV_2 VHH-s-a93 (Nb93) (chains B) QVQLVESGGGLVQPGGSLRLSCAASGFSLDNYAIGWFRQAPGKEREGVSCISSSDGSTYY TDSVEGRFTISRDNAKNTVYLQMNSLKPDDTAVYYCAADYGSSWCTFNGMDYWGQGTQVT VSS
Structural Insights into the Mechanism of a Nanobody That Stabilizes PAI-1 and Modulates Its Activity. Sillen, M., Weeks, S.D., Strelkov, S.V. et al. Int J Mol Sci (2020) 21. DOI 10.3390/ijms21165859 · PubMed
Other PDB entries of the same protein (UniProt P05121 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6ZRV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.