7DSB: Actin capping protein

Crystal structure of actin capping protein in complex with V-1 and twinfilin C-terminal tail. Determined by X-ray diffraction at 2.44 Å resolution. Released 3 Mar 2021.

Method: X-ray diffraction
Resolution: 2.44 Å
Organisms: Gallus gallus, Homo sapiens, Mus musculus
Chains: 4
Atoms: 5,169
Mol. weight: 77.13 kDa
Released: 3 Mar 2021

Explore 7DSB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DSB contains 29 α-helices and 21 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	11-22	12
α-helix	24-25	2
α-helix	29-40	12
α-helix	43-61	19
β-strand	64-65	2	1
β-strand	74-75	2	1
β-strand	81-83	3	2
β-strand	86-89	4	2
β-strand	94-99	6	2
β-strand	104-110	7	2
α-helix	118-135	18
β-strand	139-148	10	3
β-strand	151-164	14	3
α-helix	165-167	3
β-strand	169-182	14	3
β-strand	185-198	14	3
β-strand	203-217	15	3
α-helix	221-249	29
α-helix	250-254	5
α-helix	271-274	4

Chain B: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	3-15	13
α-helix	18-20	3
α-helix	21-31	11
α-helix	33-35	3
α-helix	36-40	5
β-strand	48-51	4	4
β-strand	58-61	4	4
β-strand	66-67	2	5
β-strand	70-72	3	5
β-strand	79-80	2	5
α-helix	91-112	22
β-strand	116-124	9	3
β-strand	127-138	12	3
β-strand	144-159	16	3
α-helix	160-162	3
β-strand	164-181	18	3
β-strand	185-202	18	3
α-helix	209-226	18
α-helix	227-233	7
α-helix	234-243	10

Chain C: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	3-11	9
α-helix	15-23	9
α-helix	31-32	2
α-helix	38-44	7
α-helix	48-56	9
α-helix	71-77	7
α-helix	81-89	9
α-helix	104-107	4
α-helix	111-117	7

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	323-327	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-actin-capping protein subunit alpha-1	A	protein	286	Gallus gallus	P13127 (AlphaFold model)
F-actin-capping protein subunit beta isoforms 1	B	protein	244	Gallus gallus	P14315 (AlphaFold model)
Myotrophin	C	protein	123	Homo sapiens	P58546 (AlphaFold model)
Twinfilin-1	D	protein	30	Mus musculus	Q91YR1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7DSB_1 F-actin-capping protein subunit alpha-1 (chains A)
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQW
RDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Sequence of entity 2 (B), FASTA

>7DSB_2 F-actin-capping protein subunit beta isoforms 1 (chains B)
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLR

Sequence of entity 3 (C), FASTA

>7DSB_3 Myotrophin (chains C)
GPLGSMCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLL
LKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKA
LLQ

Sequence of entity 4 (D), FASTA

>7DSB_4 Twinfilin-1 (chains D)
KQHAHKQSFAKPKGPAGKRGIRRLIRGPAE

Primary citation

Structural Insights into the Regulation of Actin Capping Protein by Twinfilin C-terminal Tail. Takeda, S., Koike, R., Fujiwara, I. et al. J Mol Biol (2021) 433:166891-166891. DOI 10.1016/j.jmb.2021.166891 · PubMed

Other PDB entries of the same protein (UniProt P13127 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DS6 1.69 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3AA0 1.7 Å, Crystal structure of Actin Capping Protein in complex with the Cp-binding motif derived…
7DS4 1.85 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail…
3AA1 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA6 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA7 1.9 Å, Crystal structure of Actin capping protein
7DS2 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail
7DS8 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3LK4 1.99 Å, Crystal structure of CapZ bound to the uncapping motif from CD2AP
9BLI 2.0 Å, Crystal structure of Actin capping protein in complex with a fragment of Legionella…
7DS3 2.09 Å, Crystal structure of actin capping protein in complex with twinflin-2 C-terminus tail
1IZN 2.1 Å, Crystal Structure of Actin Filament Capping Protein CapZ

Browse structure collections

About this viewer

MolViewer shows 7DSB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.