7EIC: AF9 YEATS domain

Crystal structure of AF9 YEATS domain in complex with H4K5acK8ac peptide. Determined by X-ray diffraction at 1.95 Å resolution. Released 6 Apr 2022.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,495
Mol. weight: 35.57 kDa
Released: 6 Apr 2022

Explore 7EIC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EIC contains 9 α-helices and 18 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	6-19	14	2
β-strand	30-37	8	2
α-helix	39-41	3
α-helix	44-46	3
β-strand	48-54	7	3
β-strand	63-66	4	3
β-strand	71-77	7	2
β-strand	80	1	1
β-strand	81-89	9	3
β-strand	97-104	8	3
α-helix	107-108	2
α-helix	112-113	2
β-strand	114-125	12	2
α-helix	129-137	9

Chain B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	6-19	14	4
β-strand	30-37	8	4
α-helix	44-46	3
β-strand	48-54	7	1
β-strand	63-66	4	1
β-strand	71-77	7	4
β-strand	82-89	8	1
β-strand	97-103	7	1
α-helix	105-108	4
α-helix	112-113	2
β-strand	114-125	12	4
α-helix	129-137	9

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	9-10	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H4	C	protein	12	Homo sapiens	P62805 (AlphaFold model)
Protein AF-9	A, B	protein	145	Homo sapiens	P42568 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>7EIC_1 Histone H4 (chains C)
SGRGKGGKGLGK

Sequence of entity 2 (A, B), FASTA

>7EIC_2 Protein AF-9 (chains A, B)
GSSGSSGMASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVF
HLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPP
VNHLRCEKLTFNNPTEDFRRKLLKA

Primary citation

Elucidation of binding preferences of YEATS domains to site-specific acetylated nucleosome core particles. Kikuchi, M., Morita, S., Goto, M. et al. J Biol Chem (2022) 298:102164-102164. DOI 10.1016/j.jbc.2022.102164 · PubMed

Other PDB entries of the same protein (UniProt P62805 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3F9X 1.25 Å, Structural Insights into Lysine Multiple Methylation by SET Domain Methyltransferases,…
8PEF 1.28 Å, Crystal structure of SLF1 Ankyrin repeat domain in complex with H4 tail (K20me0)
5TEG 1.3 Å, Crystal structure of hSETD8 in complex with histone H4K20 norleucine mutant peptide and…
3UVW 1.37 Å, Crystal Structure of the first bromodomain of human BRD4 in complex with a diacetylated…
8UK5 1.4 Å, Crystal structure of the bromodomain of human ATAD2B in complex with histone H4S1(ph)K5ac
1ZKK 1.45 Å, Crystal structure of hSET8 in ternary complex with H4 peptide (16-24) and AdoHcy
4YY6 1.45 Å, Crystal structure of BRD9 Bromodomain bound to a butyryllysine peptide
3F9Y 1.5 Å, Structural Insights into Lysine Multiple Methylation by SET Domain Methyltransferases,…
3QZT 1.5 Å, Crystal Structure of BPTF bromo in complex with histone H4K16ac - Form II
4YYI 1.5 Å, Crystal structure of BRD9 Bromodomain bound to an acetylated peptide
4YYM 1.5 Å, Crystal structure of TAF1 BD2 Bromodomain bound to a butyryllysine peptide
5FFW 1.5 Å, Crystal structure of the bromodomain of human BRPF1 in complex with H4K5acK8ac histone…

Browse structure collections

About this viewer

MolViewer shows 7EIC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.