7MLM: Mouse TLR4/MD-2

Crystal structure of mouse TLR4/MD-2 in complex with sulfatides. Determined by X-ray diffraction at 2.1 Å resolution. Released 28 Jul 2021.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Mus musculus, Eptatretus burgeri
Chains: 2
Atoms: 6,361
Mol. weight: 97.23 kDa
Ligands: ZKM, NAG
Released: 28 Jul 2021

Explore 7MLM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7MLM contains 17 α-helices and 54 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 42 β-strands

Element	Residues	Length	Sheet
α-helix	28	1
β-strand	29-32	4	1
β-strand	36-38	3	1
β-strand	57-59	3	1
β-strand	67-68	2	2
β-strand	81-83	3	1
β-strand	91-92	2	2
β-strand	105-107	3	1
β-strand	129-131	3	1
β-strand	153-155	3	1
α-helix	168-171	4
β-strand	178-180	3	1
β-strand	188-189	2	3
α-helix	192-194	3
α-helix	195-199	5
β-strand	206-208	3	1
β-strand	216-217	2	3
β-strand	226-233	8	1
α-helix	239-247	9
β-strand	253-260	8	1
α-helix	273-281	9
β-strand	283-289	7	1
α-helix	297-301	5
α-helix	303-305	3
β-strand	310-314	5	1
β-strand	332-336	5	1
β-strand	353-357	5	1
β-strand	364	1	4
β-strand	375-377	3	1
β-strand	384	1	4
β-strand	385-388	4	5
α-helix	391-394	4
β-strand	401-403	3	1
β-strand	409-412	4	5
β-strand	424-426	3	1
β-strand	431-433	3	5
β-strand	449-451	3	1
β-strand	458-459	2	6
β-strand	473-475	3	1
β-strand	480-481	2	6
α-helix	482-484	3
β-strand	485-486	2	7
β-strand	498-500	3	1
β-strand	508-509	2	7
β-strand	522-524	3	1
α-helix	535-538	4
β-strand	546-548	3	1
β-strand	570-572	3	1
β-strand	578	1	8
α-helix	586-594	9
β-strand	599-600	2	1
β-strand	604	1	9
β-strand	605	1	8
β-strand	611	1	9
α-helix	612-614	3

Chain C: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	23-26	4	10
β-strand	30-36	7	10
β-strand	37	1	11
β-strand	40	1	11
β-strand	45-49	5	12
β-strand	56-65	10	12
β-strand	74-82	9	10
β-strand	85-86	2	10
α-helix	87-89	3
β-strand	90-93	4	10
α-helix	103-106	4
α-helix	107-108	2
β-strand	113-122	10	12
α-helix	125-127	3
β-strand	129-139	11	10
β-strand	144-155	12	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Toll-like receptor 4,Variable lymphocyte receptor B	A	protein	635	Mus musculus, Eptatretus burgeri	Q4G1L2 (AlphaFold model), Q9QUK6 (AlphaFold model)
Lymphocyte antigen 96	C	protein	188	Mus musculus	Q9JHF9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7MLM_1 Toll-like receptor 4,Variable lymphocyte receptor B (chains A)
MLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPNPCIEVVPNITYQCMDQKL
SKVPDDIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHHLS
NLILTGNPIQSFSPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSC
KLPAYFSNLTNLVHVDLSYNYIQTITVNDLQFLRENPQVNLSLDMSLNPIDFIQDQAFQG
IKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGEFKDERNLEIFEPSIMEGLCDVTI
DEFRLTYTNDFSDDIVKFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFP
TLDLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGCCSYSDLGTNSLRHLDL
SFNGAIIMSANFMGLEELQHLDFQHSTLKRVTEFSAFLSLEKLLYLDISYTNTKIDFDGI
FLGLTSLNTLKMAGNSFKDNTLSNVFANTTNLTFLDLSKCQLEQISWGVFDTLHRLQLLN
MSHNNLLFLDSSHYNQLYSLKELALDTNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPR
IDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPT

Sequence of entity 2 (C), FASTA

>7MLM_2 Lymphocyte antigen 96 (chains C)
MLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPEKQQWFCNSSDAIISYSYC
DHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHG
HDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRR
DVNLVPRG

Ligands and cofactors

ID	Name	Formula	Copies
ZKM	N-[(1S,2R,3E)-2-hydroxy-1-{[(3-O-sulfo-beta-D-galactopyranosyl)oxy]methyl}hepta…	C40 H77 N O11 S	3
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

Sulfatides are endogenous ligands for the TLR4-MD-2 complex. Su, L., Athamna, M., Wang, Y. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2105316118 · PubMed

Other PDB entries of the same protein (UniProt Q4G1L2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Z62 1.7 Å, Crystal structure of the TV3 hybrid of human TLR4 and hagfish VLRB.61
2Z66 1.9 Å, Crystal structure of the VT3 hybrid of human TLR4 and hagfish VLRB.61
2Z63 2.0 Å, Crystal structure of the TV8 hybrid of human TLR4 and hagfish VLRB.61
5GY2 2.1 Å, Crystal structure of a complex between Bacillus subtilis flagellin and zebrafish…
4QXE 2.2 Å, Crystal structure of LGR4 fused with hagfish VLR
4QXF 2.25 Å, crystal structure of human LGR4 and Rspo1
6BXA 2.3 Å, Crystal structure of N-terminal fragment of Zebrafish Toll-Like Receptor 5 (TLR5) with…
2O6R 2.3 Å, Structural diversity of the hagfish Variable Lymphocyte Receptors B61
4BV4 2.35 Å, Structure and allostery in Toll-Spatzle recognition
3UL7 2.37 Å, Crystal structure of the TV3 mutant F63W
4QDH 2.4 Å, Crystal Structure of the C-terminal Domain of Mouse TLR9
3A7C 2.4 Å, Crystal structure of TLR2-PE-DTPA complex

Browse structure collections

About this viewer

MolViewer shows 7MLM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.