7P0V: Human SF3A1 ubiquitin-like domain

Crystal structure of human SF3A1 ubiquitin-like domain in complex with U1 snRNA stem-loop 4. Determined by X-ray diffraction at 1.56 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 1.56 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,270
Mol. weight: 18.13 kDa
Released: 20 Apr 2022

Explore 7P0V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7P0V contains 3 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	704-710	7	1
β-strand	713	1	2
β-strand	723	1	2
β-strand	726-732	7	1
β-strand	736	1	3
α-helix	737-748	12
α-helix	752-754	3
β-strand	755-758	4	1
β-strand	759	1	4
β-strand	762	1	4
β-strand	769	1	3
α-helix	771-773	3
β-strand	779-785	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Splicing factor 3A subunit 1	A	protein	93	Homo sapiens	Q15459 (AlphaFold model)
RNA (5'-r(pgpgpgpgpapcpupgpcpgpupupcpgpcpgpcpupupupcpcpcpc)-3')	B	RNA	24	Homo sapiens

Sequence of entity 1 (A), FASTA

>7P0V_1 Isoform 2 of Splicing factor 3A subunit 1 (chains A)
GGSPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYE
GIFIKDSNSLAYYNMANGAVIHLALKERGGRKK

Sequence of entity 2 (B), FASTA

>7P0V_2 RNA (5'-R(P*GP*GP*GP*GP*AP*CP*UP*GP*CP*GP*UP*UP*CP*GP*CP*GP*CP*UP*UP*UP*CP*CP*CP*C)-3') (chains B)
GGGGACUGCGUUCGCGCUUUCCCC

Primary citation

Sequence-specific RNA recognition by an RGG motif connects U1 and U2 snRNP for spliceosome assembly. de Vries, T., Martelly, W., Campagne, S. et al. Proc Natl Acad Sci U S A (2022) 119. DOI 10.1073/pnas.2114092119 · PubMed

Other PDB entries of the same protein (UniProt Q15459 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ID2 1.8 Å, Crystal structure of the ubiquitin-like domain in the SF3A1 subunit of human U2 snRNP…
7EVO 2.5 Å, The cryo-EM structure of the human 17S U2 snRNP
8H6L 2.6 Å, Cryo-EM structure of human exon-defined spliceosome in the early B state.
8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
8HK1 2.7 Å, The cryo-EM structure of human pre-17S U2 snRNP
7VPX 3.0 Å, The cryo-EM structure of the human pre-A complex
8I0R 3.0 Å, The cryo-EM structure of human Bact-I complex
8I0T 3.0 Å, The cryo-EM structure of human Bact-III complex
8Q7N 3.1 Å, cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)
8QOZ 3.1 Å, Cryo-EM Structure of Pre-B+5'ss+ATPgammaS Complex (core part)
8QPE 3.1 Å, Cryo-EM Structure of Pre-B-like Complex (core part)
8H6E 3.2 Å, Cryo-EM structure of human exon-defined spliceosome in the late pre-B state.

Browse structure collections

About this viewer

MolViewer shows 7P0V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.