7Q6C: Complement C6 FIM1-2

complement C6 FIM1-2 bound to CP010 antibody. Determined by X-ray diffraction at 2.29 Å resolution. Released 25 May 2022.

Method: X-ray diffraction
Resolution: 2.29 Å
Organisms: Homo sapiens, Mus musculus, Lama glama
Chains: 4
Atoms: 5,654
Mol. weight: 79.25 kDa
Released: 25 May 2022

Explore 7Q6C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Q6C contains 29 α-helices and 70 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	777-780	4	1
β-strand	783-786	4	1
α-helix	787-788	2
β-strand	799-804	6	2
β-strand	809-814	6	2
α-helix	815-823	9
β-strand	829-834	6	2
α-helix	841-852	12
α-helix	853-855	3
β-strand	860-862	3	3
β-strand	865-867	3	3
β-strand	871-874	4	4
β-strand	879-882	4	4
α-helix	883-884	2
α-helix	885-887	3
α-helix	893-894	2
β-strand	895-900	6	5
β-strand	907-910	4	5
α-helix	911-919	9
β-strand	924-929	6	5

Chain H: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	10-12	3	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-39	6	7
β-strand	45-51	7	7
β-strand	58-60	3	7
β-strand	68-73	6	6
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-98	7	7
β-strand	107-108	2	7
β-strand	112-116	5	7
α-helix	120-121	2
β-strand	122	1	8
α-helix	123-124	2
β-strand	125-129	5	9
β-strand	140-150	11	9
β-strand	151	1	8
β-strand	156-159	4	10
α-helix	160-162	3
β-strand	164	1	10
β-strand	168-170	3	9
α-helix	171-173	3
β-strand	174-175	2	9
β-strand	181-190	10	9
α-helix	191-194	4
β-strand	200-205	6	10
α-helix	206-208	3
β-strand	210-215	6	10

Chain K: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	11
β-strand	15-16	2	12
β-strand	22-29	8	11
α-helix	33-35	3
β-strand	38-43	6	13
β-strand	50-55	6	13
β-strand	62-64	3	13
β-strand	72-77	6	11
β-strand	82-87	6	11
α-helix	92-94	3
β-strand	96-103	8	13
β-strand	112-115	4	13
β-strand	119-121	3	13
β-strand	122-123	2	12

Chain L: 11 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-7	4	14
β-strand	10-13	4	15
β-strand	19-25	7	14
β-strand	30	1	16
β-strand	36	1	16
β-strand	38-43	6	15
β-strand	50-54	5	15
β-strand	58-59	2	15
α-helix	60	1
β-strand	67-72	6	14
β-strand	75-80	6	14
α-helix	85-87	3
β-strand	89-95	7	15
α-helix	101	1
β-strand	102-103	2	15
β-strand	104	1	14
β-strand	107-111	5	15
α-helix	112	1
β-strand	116	1	17
α-helix	117-118	2
β-strand	119-123	5	18
α-helix	124-126	3
α-helix	127-131	5
β-strand	134-144	11	18
β-strand	145	1	17
β-strand	150-155	6	19
β-strand	158-159	2	19
α-helix	160	1
β-strand	164-168	5	18
α-helix	169-172	4
β-strand	178-187	10	18
α-helix	188-191	4
β-strand	196-202	7	19
β-strand	210-215	6	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement component C6	A	protein	166	Homo sapiens	P13671 (AlphaFold model)
CP010 heavy chain	H	protein	219	Mus musculus
kappa specific nanobody	K	protein	122	Lama glama
CP010 light chain	L	protein	219	Mus musculus

Sequence of entity 1 (A), FASTA

>7Q6C_1 Complement component C6 (chains A)
LKGHCQLGQKQSGSECICMSPEEDCSHHSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQ
LHFLHIGSCQDGRQLEWGLERTRLSSASTKKESCGYDTCYDWEKCSASTSKCVCLLPPQC
FKGGNQLYCVKMGSSTSEKTLNICEVGTIRCANRKMEILHPGKCLA

Sequence of entity 2 (H), FASTA

>7Q6C_2 CP010 heavy chain (chains H)
EVQLVESDGGLVQPGGSLKLSCAASGFTFSDYYMAWVRQGPGKGLEWVATINYDGSSTYY
RESVKGRFTISRDNAKNTLYLQMNSLRAEDTATYYCARPSTEALFAYWGHGTLVTVSSAS
TKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESS

Sequence of entity 3 (K), FASTA

>7Q6C_3 kappa specific nanobody (chains K)
QVQLQESGGGLVQPGGSLRLSCAASGRTISRYAMSWFRQAPGKEREFVAVARRSGDGAFY
ADSVQGRFTVSRDDAKNTVYLQMNSLKPEDTAVYYCAIDSDTFYSGSYDYWGQGTQVTVS
SE

Sequence of entity 4 (L), FASTA

>7Q6C_4 CP010 light chain (chains L)
DVVLTQTPSTLSVTPGQPASISCRSSQSLLNDVGNTYLYWYLQKPGQSPQLLIYLVSDLG
SGVPNRFSGSGSGTDFTLKISRVEAEDVGIYYCMQASHAPYTFGQGTNLEIKRTVAAPSV
FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

Development, Characterization, and in vivo Validation of a Humanized C6 Monoclonal Antibody that Inhibits the Membrane Attack Complex. Gytz Olesen, H., Michailidou, I., Zelek, W.M. et al. J Innate Immun (2022):1-21. DOI 10.1159/000524587 · PubMed

Other PDB entries of the same protein (UniProt P13671 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3T5O 2.87 Å, Crystal Structure of human Complement Component C6
8B0F 3.0 Å, CryoEM structure of C5b8-CD59
7NYD 3.27 Å, cryoEM structure of 2C9-sMAC
8B0G 3.3 Å, 2C9, C5b9-CD59 structure
8B0H 3.3 Å, 2C9, C5b9-CD59 cryoEM structure
4A5W 3.5 Å, Crystal structure of C5b6
7NYC 3.54 Å, cryoEM structure of 3C9-sMAC
4E0S 4.21 Å, Crystal Structure of C5b-6
6H03 5.6 Å, Open conformation of the membrane attack complex
6H04 5.6 Å, Closed conformation of the Membrane Attack Complex

Browse structure collections

About this viewer

MolViewer shows 7Q6C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.