7QCS: PALS1/MPP5 PDZ domain

PALS1/MPP5 PDZ domain in complex with SARS-CoV-2_E PBM peptide. Determined by X-ray diffraction at 2.8 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Homo sapiens, Severe acute respiratory syndrome coronavirus 2
Chains: 5
Atoms: 2,201
Mol. weight: 35.43 kDa
Released: 20 Apr 2022

Explore 7QCS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QCS contains 5 α-helices and 19 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	19-25	7	1
β-strand	33-38	6	1
β-strand	41-47	7	1
α-helix	52-56	5
β-strand	64-68	5	1
β-strand	71-72	2	1
α-helix	78-86	9
β-strand	90-97	8	1

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	171	1	1

Chain E: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	19-25	7	3
β-strand	33-38	6	3
β-strand	41-47	7	3
β-strand	64-68	5	3
β-strand	71-72	2	3
α-helix	78-86	9
β-strand	90-97	8	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein PALS1	A, B, E	protein	100	Homo sapiens	Q8N3R9 (AlphaFold model)
Envelope small membrane protein	C, D	protein	12	Severe acute respiratory syndrome coronavirus 2	P0DTC4 (AlphaFold model)

Sequence of entity 1 (A, B, E), FASTA

>7QCS_1 Protein PALS1 (chains A, B, E)
GTDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLH
EGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQ

Sequence of entity 2 (C, D), FASTA

>7QCS_2 Envelope small membrane protein (chains C, D)
NLNSSRVPDLLV

Primary citation

Interactions of Severe Acute Respiratory Syndrome Coronavirus 2 Protein E With Cell Junctions and Polarity PSD-95/Dlg/ZO-1-Containing Proteins. Zhu, Y., Alvarez, F., Wolff, N. et al. Front Microbiol (2022) 13:829094-829094. DOI 10.3389/fmicb.2022.829094 · PubMed

Other PDB entries of the same protein (UniProt Q8N3R9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UU5 1.23 Å, Crystal structure of the PDZ domain of PALS1 in complex with the crb peptide
7NTJ 1.74 Å, PALS1 PDZ1 domain with SARS-CoV-1_E PBM complex
4UU6 1.8 Å, Crystal structure of the PDZ domain of PALS1
7NTK 1.9 Å, PALS1 PDZ1 domain with SARS-CoV-2_E PBM complex
3UIT 2.05 Å, Overall structure of Patj/Pals1/Mals complex
4WSI 2.95 Å, Crystal Structure of PALS1/Crb complex
7M4R 3.65 Å, Structural basis for SARS-CoV-2 envelope protein in recognition of human cell junction…
1Y76 Solution Structure of Patj/Pals1 L27 Domain Complex

Browse structure collections

About this viewer

MolViewer shows 7QCS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.