rsKiiro Thermal annealing at 290K of 200K Cis intermediate. Determined by X-ray diffraction at 1.32 Å resolution. Released 5 Jul 2023.
Explore 7QLL in 3D Show helices and sheets RCSB PDB PDBe
7QLL contains 6 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-18 | 11 | 1 |
| β-strand | 21-32 | 12 | 1 |
| β-strand | 37-46 | 10 | 1 |
| α-helix | 48 | 1 | |
| α-helix | 50 | 1 | |
| α-helix | 54-57 | 4 | |
| β-strand | 70 | 1 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 87-95 | 9 | 1 |
| β-strand | 100-110 | 11 | 1 |
| β-strand | 113-123 | 11 | 1 |
| β-strand | 136-139 | 4 | 1 |
| α-helix | 140-141 | 2 | |
| β-strand | 142-149 | 8 | 1 |
| β-strand | 152-163 | 12 | 1 |
| β-strand | 167-179 | 13 | 1 |
| α-helix | 184-188 | 5 | |
| β-strand | 190-201 | 12 | 1 |
| β-strand | 207-217 | 11 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| rsKiiro | A | protein | 220 | Lobophyllia hemprichii | Q5S6Z9 (AlphaFold model) |
>7QLL_1 rsKiiro (chains A) MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTA FAYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVRF YGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDVETALLLEGNAHYRCDFRTTYKAK EKGVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPN
Optical control of ultrafast structural dynamics in a fluorescent protein. Hutchison, C.D.M., Baxter, J.M., Fitzpatrick, A. et al. Nat Chem (2023) 15:1607-1615. DOI 10.1038/s41557-023-01275-1 · PubMed
Other PDB entries of the same protein (UniProt Q5S6Z9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7QLL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.