7TSS: Trans-state rsEospa

Name: PDB 7TSS: Room temperature rsEospa Trans-state structure at pH 8.4
Published: 2022-12-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

Room temperature rsEospa Trans-state structure at pH 8.4. Determined by X-ray diffraction at 1.75 Å resolution. Released 14 Dec 2022.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Lobophyllia hemprichii
Chains: 1
Atoms: 1,925
Mol. weight: 25.64 kDa
Released: 14 Dec 2022

Explore 7TSS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TSS contains 7 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	8-18	11	1
β-strand	21-32	12	1
β-strand	37-46	10	1
α-helix	48	1
α-helix	50	1
α-helix	54-60	7
β-strand	70	1	1
α-helix	80-82	3
β-strand	87-95	9	1
β-strand	100-110	11	1
β-strand	113-123	11	1
α-helix	130-133	4
β-strand	136-139	4	1
α-helix	140-141	2
β-strand	142-149	8	1
β-strand	152-163	12	1
β-strand	167-179	13	1
α-helix	184-188	5
β-strand	190-201	12	1
β-strand	207-217	11	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Trans-state rsEospa	A	protein	224	Lobophyllia hemprichii	Q5S6Z9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7TSS_1 Trans-state rsEospa (chains A)
MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTA
FXNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVRFYG
TNFPANGPVMQKKTLKWEPATEKMYVRDGVLTGDVETALLLEGNAHYRCDFRTTYKAKEK
GVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Primary citation

Observation of Cation Chromophore Photoisomerization of a Fluorescent Protein Using Millisecond Synchrotron Serial Crystallography and Infrared Vibrational and Visible Spectroscopy. Baxter, J.M., Hutchison, C.D.M., Maghlaoui, K. et al. J Phys Chem B (2022) 126:9288-9296. DOI 10.1021/acs.jpcb.2c06780 · PubMed

Other PDB entries of the same protein (UniProt Q5S6Z9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QLJ 1.02 Å, Trans structure of rsKiiro Illuminated at 290 K
7QLI 1.16 Å, Cis structure of rsKiiro at 290 K
7QLM 1.3 Å, rsKiiro trans chromophore dark structure by SFX
7QLO 1.31 Å, rsKiiro pump dump probe structure by TR-SFX
7QLL 1.32 Å, rsKiiro Thermal annealing at 290K of 200K Cis intermediate
9J0Q 1.34 Å, Structure of mEos3.2 in the green fluorescent state
7QLK 1.46 Å, Cis structure intermediate of rsKiiro Illuminated at 200 K
6GP0 1.5 Å, Structure of mEos4b in the red fluorescent state
7QLN 1.5 Å, rsKiiro pump probe structure by TR-SFX
6GP1 1.5 Å, Structure of mEos4b in the red long-lived dark state
5OQ9 1.51 Å, XFEL structure of the off state of a reversibly photoswitching fluorescent protein…
5OQA 1.53 Å, XFEL structure of the off state of a reversibly photoswitching fluorescent protein…

Browse structure collections

About this viewer

MolViewer shows 7TSS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.