7UZP: PDB entry 7UZP

parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing three beta-amino acids. Determined by X-ray diffraction at 2.29 Å resolution. Released 19 Oct 2022.

Method: X-ray diffraction
Resolution: 2.29 Å
Organism: Homo sapiens
Chains: 6
Atoms: 3,165
Mol. weight: 44.51 kDa
Ligands: ZN
Released: 19 Oct 2022

Explore 7UZP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UZP contains 24 α-helices and 30 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	31-33	3
α-helix	34-57	24
α-helix	63	1
β-strand	64	1	1
α-helix	65-66	2
β-strand	67-68	2	2
β-strand	73-74	2	2
β-strand	77	1	1
β-strand	81-86	6	3
α-helix	87-88	2
β-strand	99-104	6	3
β-strand	110	1	3
α-helix	111	1
β-strand	112	1	4
α-helix	113	1
β-strand	119	1	4
β-strand	121-122	2	3

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	16-31	16

Chain C: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	31-33	3
α-helix	34-57	24
β-strand	64	1	5
α-helix	65-66	2
β-strand	67-68	2	6
β-strand	73-74	2	6
β-strand	77	1	5
β-strand	81-86	6	7
α-helix	87-88	2
β-strand	99-104	6	7
β-strand	110	1	7
α-helix	111	1
β-strand	112	1	8
α-helix	113	1
β-strand	119	1	8
β-strand	122	1	7

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	17-31	15

Chain E: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	31-33	3
α-helix	34-57	24
α-helix	63	1
β-strand	64	1	9
α-helix	65-66	2
β-strand	67-68	2	10
β-strand	73-74	2	10
β-strand	77	1	9
β-strand	81-86	6	11
α-helix	87-88	2
β-strand	99-104	6	11
β-strand	110	1	11
α-helix	111	1
β-strand	112	1	12
α-helix	113	1
β-strand	119	1	12
β-strand	121-122	2	11
α-helix	124-126	3

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	18-31	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Parathyroid hormone/parathyroid hormone-related peptide receptor	A, C, E	protein	103	Homo sapiens	Q03431 (AlphaFold model)
PTHrP[1-36] 24,28,31 xcp	B, D, F	protein	22	Homo sapiens	P12272 (AlphaFold model)

Sequence of entity 1 (A, C, E), FASTA

>7UZP_1 Parathyroid hormone/parathyroid hormone-related peptide receptor (chains A, C, E)
GDDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAPGEVVAVPC
PDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFL

Sequence of entity 2 (B, D, F), FASTA

>7UZP_2 PTHrP[1-36] 24,28,31 XCP (chains B, D, F)
YQDLRRRFFXHHLXAEXHTAEI

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Altered signaling at the PTH receptor via modified agonist contacts with the extracellular domain provides a path to prolonged agonism in vivo. Liu, S., Yu, Z., Daley, E.J. et al. Proc Natl Acad Sci U S A (2022) 119:e2212736119-e2212736119. DOI 10.1073/pnas.2212736119 · PubMed

Other PDB entries of the same protein (UniProt Q03431 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EMB 0.85 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal phosphorylated PTHR…
4Z8J 0.95 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal PTHR PDZ binding motif
7UZO 1.3 Å, Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
3H3G 1.94 Å, Crystal structure of the extracellular domain of the human parathyroid hormone receptor…
3C4M 1.95 Å, Structure of human parathyroid hormone in complex with the extracellular domain of its…
8D51 2.0 Å, Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
8D52 2.02 Å, Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
8BIA 2.4 Å, Crystal structure of Scribble PDZ1 with PTHR
6FJ3 2.5 Å, High resolution crystal structure of parathyroid hormone 1 receptor in complex with a…
8FLQ 2.55 Å, Human PTH1R in complex with PTH(1-34) and Gs
8JR9 2.57 Å, Small molecule agonist (PCO371) bound to human parathyroid hormone receptor type 1 (PTH1R)
8YG4 2.59 Å, A cryo-EM structure of LA-PTH-R1-PTH1R-Gs complex structure

Browse structure collections

About this viewer

MolViewer shows 7UZP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.