7VU5: Transmembrane domain of the CD28 dimer

Structure of the transmembrane domain of the CD28 dimer. Determined by solution NMR. Released 2 Mar 2022.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 666
Mol. weight: 9.33 kDa
Released: 2 Mar 2022

Explore 7VU5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VU5 contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	153-182	30

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	152-182	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-cell-specific surface glycoprotein CD28	A, B	protein	41	Homo sapiens	P10747 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7VU5_1 T-cell-specific surface glycoprotein CD28 (chains A, B)
GPSKPFWVLVVVGGVLAFYSLLVTVAFIIFWVRSKRSRLLH

Primary citation

Structural characterization of a dimerization interface in the CD28 transmembrane domain. Wu, H., Cao, R., Wen, M. et al. Structure (2022) 30:803-812.e5. DOI 10.1016/j.str.2022.03.004 · PubMed

Other PDB entries of the same protein (UniProt P10747 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GJI 0.9 Å, PI3K p85 N-terminal SH2 domain/CD28-derived peptide complex
5AUL 1.1 Å, PI3K p85 C-terminal SH2 domain/CD28-derived peptide complex
5GJH 1.2 Å, Gads SH2 domain/CD28-derived peptide complex
3WA4 1.35 Å, Grb2 SH2 domain/CD28-derived peptide complex
7PPN 1.9 Å, SHP2 catalytic domain in complex with CD28 (183-198) phosphopeptide (pTyr-191, p-Thr-195)
1YJD 2.7 Å, Crystal structure of human CD28 in complex with the Fab fragment of a mitogenic antibody…
8S6Z 3.05 Å, CD28 in complex with the antibody Fab fragment AI3
6O8D 3.55 Å, Anti-CD28xCD3 CODV Fab bound to CD28
8W2V Solution Structure of the CD28 hinge used in chimeric antigen receptor (CAR) T-cells

Browse structure collections

About this viewer

MolViewer shows 7VU5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.