8W2V: T-cell-specific surface glycoprotein CD28

Solution Structure of the CD28 hinge used in chimeric antigen receptor (CAR) T-cells. Determined by solution NMR. Released 11 Sept 2024.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 303
Mol. weight: 4.31 kDa
Released: 11 Sept 2024

Explore 8W2V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8W2V contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	120-121	2
α-helix	124-128	5
α-helix	141-143	3
β-strand	144	1	1
β-strand	146	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-cell-specific surface glycoprotein CD28	A	protein	39	Homo sapiens	P10747 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8W2V_1 T-cell-specific surface glycoprotein CD28 (chains A)
IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

Primary citation

CD28 hinge used in chimeric antigen receptor (CAR) T-cells exhibits local structure and conformational exchange amidst global disorder. Folimonova, V., Chen, X., Negi, H. et al. Commun Biol (2024) 7:1072-1072. DOI 10.1038/s42003-024-06770-w · PubMed

Other PDB entries of the same protein (UniProt P10747 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GJI 0.9 Å, PI3K p85 N-terminal SH2 domain/CD28-derived peptide complex
5AUL 1.1 Å, PI3K p85 C-terminal SH2 domain/CD28-derived peptide complex
5GJH 1.2 Å, Gads SH2 domain/CD28-derived peptide complex
3WA4 1.35 Å, Grb2 SH2 domain/CD28-derived peptide complex
7PPN 1.9 Å, SHP2 catalytic domain in complex with CD28 (183-198) phosphopeptide (pTyr-191, p-Thr-195)
1YJD 2.7 Å, Crystal structure of human CD28 in complex with the Fab fragment of a mitogenic antibody…
8S6Z 3.05 Å, CD28 in complex with the antibody Fab fragment AI3
6O8D 3.55 Å, Anti-CD28xCD3 CODV Fab bound to CD28
7VU5 Structure of the transmembrane domain of the CD28 dimer

Browse structure collections

About this viewer

MolViewer shows 8W2V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.