7W8G: MCM double hexamer

Cryo-EM structure of MCM double hexamer. Determined by electron microscopy at 2.52 Å resolution. Released 13 Apr 2022.

Method: Electron microscopy
Resolution: 2.52 Å
Organism: Saccharomyces cerevisiae S288C
Chains: 12
Atoms: 62,460
Mol. weight: 1219.77 kDa
Ligands: ZN, MG, AGS, ADP
Released: 13 Apr 2022

Explore 7W8G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7W8G contains 403 α-helices and 358 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 2: 33 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	183-187	5
α-helix	194-199	6
α-helix	201-217	17
α-helix	226-236	11
β-strand	241-245	5	1
α-helix	246-252	7
α-helix	254-262	9
α-helix	264-282	19
α-helix	286-289	4
β-strand	294-298	5	1
β-strand	304	1	2
α-helix	306-308	3
α-helix	311-313	3
β-strand	316-327	12	2
β-strand	331-341	11	3
β-strand	346	1	4
β-strand	347-352	6	3
α-helix	353-354	2
β-strand	373-375	3	3
β-strand	381-385	5	3
β-strand	386-391	6	2
α-helix	402-404	3
β-strand	405-410	6	2
α-helix	412-414	3
β-strand	423-432	10	2
α-helix	433-434	2
β-strand	446	1	5
β-strand	449-458	10	2
α-helix	478-488	11
α-helix	493-500	8
α-helix	509-520	12
β-strand	525-527	3	6
β-strand	531-533	3	6
β-strand	539-543	5	7
α-helix	549-559	11
β-strand	563-567	5	7
β-strand	579-582	4	8
β-strand	589-592	4	8
α-helix	594-598	5
β-strand	603-607	5	7
α-helix	609-611	3
α-helix	614-626	13
β-strand	628-633	6	9
β-strand	636-641	6	9
β-strand	645-650	6	7
α-helix	653-655	3
α-helix	663-666	4
α-helix	671-675	5
β-strand	679-683	5	7
α-helix	689-705	17
α-helix	757-759	3
α-helix	760-773	14
β-strand	777	1	10
α-helix	780-782	3
α-helix	783-800	18
α-helix	807-823	17
β-strand	828	1	10
α-helix	831-847	17
α-helix	851-860	10
α-helix	862-865	4

Chain 3: 31 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	19-34	16
α-helix	36-58	23
β-strand	95-99	5	11
α-helix	100-106	7
α-helix	108-116	9
α-helix	118-136	19
α-helix	151-153	3
β-strand	154-158	5	11
α-helix	162-164	3
β-strand	165-166	2	12
α-helix	173-175	3
β-strand	178-189	12	12
α-helix	190-192	3
β-strand	193-203	11	13
β-strand	208-213	6	13
α-helix	229-232	4
β-strand	234	1	14
β-strand	240	1	14
β-strand	241-243	3	13
β-strand	249-253	5	13
β-strand	254-259	6	12
α-helix	260-261	2
α-helix	270-271	2
β-strand	273-278	6	12
α-helix	280-282	3
β-strand	291-301	11	12
β-strand	318-330	13	12
α-helix	337-338	2
α-helix	341-343	3
α-helix	344-354	11
α-helix	359-363	5
α-helix	375-386	12
β-strand	391-392	2	15
β-strand	398-399	2	15
β-strand	405-409	5	16
α-helix	415-425	11
β-strand	429-432	4	16
α-helix	439-442	4
β-strand	444-448	5	17
β-strand	455-459	5	17
α-helix	461-464	4
β-strand	468-472	5	16
α-helix	475-477	3
α-helix	480-492	13
β-strand	494-498	5	18
β-strand	503-507	5	18
β-strand	510-516	7	16
α-helix	529-533	5
α-helix	537-542	6
β-strand	545-549	5	16
α-helix	555-568	14
α-helix	581-583	3
β-strand	589-590	2	12
α-helix	653-666	14
β-strand	670	1	19
α-helix	673-687	15
α-helix	700-715	16
β-strand	720	1	19
α-helix	723-737	15

Chain 4: 36 helices, 35 β-strands

Element	Residues	Length	Sheet
α-helix	187-200	14
β-strand	202	1	20
α-helix	203-209	7
α-helix	218-221	4
β-strand	224	1	20
α-helix	225-236	12
β-strand	240-244	5	21
α-helix	245-250	6
α-helix	255-263	9
α-helix	265-286	22
α-helix	293-298	6
β-strand	302-306	5	21
α-helix	319-321	3
β-strand	325-335	11	22
α-helix	336-338	3
β-strand	339-349	11	22
β-strand	355-359	5	22
β-strand	361	1	23
β-strand	364-367	4	23
β-strand	370	1	24
β-strand	379	1	24
β-strand	382-384	3	22
β-strand	390-401	12	22
α-helix	410-412	3
β-strand	414-420	7	22
α-helix	421-423	3
β-strand	432-442	11	22
β-strand	445	1	25
α-helix	452	1
β-strand	453-454	2	25
β-strand	456	1	26
α-helix	457	1
β-strand	458-467	10	22
α-helix	474-477	4
α-helix	478-480	3
α-helix	482-491	10
α-helix	503-512	10
α-helix	518-524	7
α-helix	534-545	12
α-helix	547-549	3
β-strand	550-551	2	27
β-strand	557-558	2	27
α-helix	561-563	3
β-strand	564-568	5	28
α-helix	574-584	11
β-strand	590-592	3	28
β-strand	596	1	29
α-helix	598-602	5
β-strand	603-607	5	30
β-strand	614-618	5	30
α-helix	620-623	4
β-strand	628-632	5	28
α-helix	634-636	3
α-helix	639-642	4
α-helix	645-651	7
β-strand	653-657	5	31
β-strand	662-666	5	31
β-strand	670-675	6	28
α-helix	688-692	5
α-helix	696-699	4
β-strand	704-708	5	28
α-helix	714-726	13
α-helix	727-729	3
α-helix	744-757	14
β-strand	761-762	2	32
α-helix	764-780	17
α-helix	795-811	17
β-strand	816-817	2	32
α-helix	819-832	14
β-strand	838	1	33
β-strand	845	1	33

Chain 5: 33 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	34
α-helix	18-19	2
α-helix	24-37	14
α-helix	45-56	12
β-strand	60-64	5	35
α-helix	65-71	7
α-helix	73-81	9
α-helix	83-104	22
α-helix	134-135	2
β-strand	136-140	5	35
α-helix	144-145	2
β-strand	146	1	36
α-helix	147	1
α-helix	148-150	3
α-helix	153-155	3
β-strand	159-169	11	36
α-helix	171-172	2
β-strand	173-176	4	36
β-strand	178-183	6	37
β-strand	189-193	5	37
α-helix	213-216	4
β-strand	241-244	4	37
α-helix	245-247	3
β-strand	250-259	10	36
α-helix	270-272	3
β-strand	273-279	7	36
α-helix	280-282	3
β-strand	291-301	11	36
β-strand	323	1	3
β-strand	325-335	11	36
α-helix	351-361	11
α-helix	366-373	8
α-helix	382-393	12
β-strand	398-399	2	38
β-strand	405-406	2	38
β-strand	412-416	5	39
α-helix	422-432	11
β-strand	436-440	5	39
β-strand	443	1	39
β-strand	446	1	9
β-strand	452-455	4	40
β-strand	462-466	5	40
α-helix	468-471	4
β-strand	476-480	5	39
α-helix	487-498	12
β-strand	501-505	5	41
β-strand	510-514	5	41
β-strand	518-523	6	39
α-helix	536-539	4
α-helix	545-548	4
β-strand	552-556	5	39
α-helix	562-577	16
α-helix	579-590	12
α-helix	596-609	14
β-strand	613-614	2	42
α-helix	616-618	3
α-helix	619-640	22
α-helix	650-666	17
β-strand	671-672	2	42
α-helix	674-684	11
α-helix	685-689	5
α-helix	690-694	5

Chain 6: 35 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	102-104	3
α-helix	106-121	16
β-strand	124-125	2	43
β-strand	132-133	2	43
α-helix	135-146	12
β-strand	150-154	5	44
α-helix	155-159	5
α-helix	165-172	8
α-helix	174-192	19
α-helix	194-197	4
α-helix	261-263	3
β-strand	264-268	5	44
β-strand	274	1	5
α-helix	276-278	3
α-helix	281-283	3
β-strand	284	1	5
β-strand	287-297	11	5
β-strand	301-311	11	5
β-strand	317-322	6	5
β-strand	344-362	19	5
α-helix	372-374	3
β-strand	376-382	7	5
α-helix	383-385	3
β-strand	394-405	12	5
α-helix	407-411	5
α-helix	415-417	3
β-strand	418-421	4	23
α-helix	422	1
β-strand	428	1	45
β-strand	445-447	3	23
β-strand	450-462	13	5
α-helix	501-507	7
α-helix	510-520	11
α-helix	525-532	8
α-helix	541-552	12
β-strand	557-558	2	46
β-strand	564-565	2	46
β-strand	571-575	5	47
α-helix	581-591	11
β-strand	596-599	4	47
β-strand	603	1	31
α-helix	605-608	4
β-strand	610-614	5	48
β-strand	621-625	5	48
α-helix	627-630	4
β-strand	635-639	5	47
α-helix	641-643	3
α-helix	646-658	13
β-strand	660-663	4	49
β-strand	670-673	4	49
β-strand	677-682	6	47
α-helix	689-690	2
α-helix	695-698	4
α-helix	703-707	5
β-strand	711-715	5	47
α-helix	721-737	17
α-helix	738-741	4
α-helix	748-758	11
β-strand	764-765	2	50
α-helix	767-787	21
α-helix	788-790	3
β-strand	791	1	51
α-helix	797-813	17
β-strand	818-819	2	50
α-helix	821-834	14
β-strand	837	1	51
α-helix	838-839	2

Chain 7: 33 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	13
α-helix	14-27	14
α-helix	62-71	10
β-strand	77-81	5	52
α-helix	82-95	14
α-helix	102-108	7
α-helix	110-123	14
α-helix	126-128	3
α-helix	131-132	2
α-helix	138-164	27
α-helix	174-188	15
α-helix	194-196	3
β-strand	201-205	5	52
α-helix	206-208	3
α-helix	209-214	6
β-strand	224-225	2	26
α-helix	226	1
α-helix	232-234	3
β-strand	238-248	11	26
α-helix	249-251	3
β-strand	252-262	11	26
β-strand	267-272	6	26
β-strand	277-278	2	25
β-strand	283	1	53
α-helix	287-291	5
α-helix	295-296	2
β-strand	297	1	53
β-strand	298-316	19	26
α-helix	323	1
β-strand	330-336	7	26
α-helix	337-339	3
β-strand	348-359	12	26
β-strand	371	1	13
β-strand	372-383	12	26
α-helix	395-407	13
α-helix	410-416	7
α-helix	426-437	12
β-strand	442-443	2	54
β-strand	449-450	2	54
β-strand	456-460	5	55
α-helix	466-476	11
β-strand	480-483	4	55
β-strand	488	1	18
β-strand	495-500	6	56
β-strand	505-510	6	56
α-helix	512-515	4
β-strand	520-523	4	55
α-helix	526-528	3
α-helix	531-543	13
β-strand	545-549	5	29
β-strand	554-558	5	29
β-strand	562-567	6	55
α-helix	588-593	6
β-strand	596-600	5	55
α-helix	606-622	17
α-helix	631-634	4
α-helix	635-647	13
β-strand	651	1	57
α-helix	654-674	21
α-helix	686-702	17
β-strand	707	1	57
α-helix	710-729	20

Chain B: 33 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	183-187	5
α-helix	194-199	6
α-helix	201-217	17
α-helix	226-237	12
β-strand	241-245	5	58
α-helix	246-252	7
α-helix	254-262	9
α-helix	264-282	19
α-helix	286-289	4
β-strand	294-298	5	58
β-strand	304	1	59
α-helix	306-308	3
α-helix	311-313	3
β-strand	316-327	12	59
β-strand	331-341	11	60
β-strand	346	1	45
β-strand	347-352	6	60
α-helix	353-354	2
β-strand	373-375	3	60
β-strand	381-385	5	60
β-strand	386-391	6	59
α-helix	402-404	3
β-strand	405-410	6	59
α-helix	412-414	3
β-strand	423-432	10	59
α-helix	433-434	2
β-strand	446	1	61
β-strand	449-458	10	59
α-helix	478-488	11
α-helix	493-500	8
α-helix	509-520	12
β-strand	525-527	3	62
β-strand	531-533	3	62
β-strand	539-543	5	63
α-helix	549-559	11
β-strand	563-567	5	63
β-strand	579-582	4	64
β-strand	589-592	4	64
α-helix	594-598	5
β-strand	603-607	5	63
α-helix	609-611	3
α-helix	614-626	13
β-strand	628-633	6	65
β-strand	636-641	6	65
β-strand	645-650	6	63
α-helix	653-655	3
α-helix	663-666	4
α-helix	671-675	5
β-strand	679-683	5	63
α-helix	689-705	17
α-helix	757-759	3
α-helix	760-773	14
β-strand	777	1	66
α-helix	780-782	3
α-helix	783-800	18
α-helix	807-823	17
β-strand	828	1	66
α-helix	831-847	17
α-helix	851-860	10
α-helix	862-865	4

Chain C: 30 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	19-34	16
α-helix	36-58	23
β-strand	95-99	5	67
α-helix	100-106	7
α-helix	108-116	9
α-helix	118-136	19
α-helix	151-153	3
β-strand	154-158	5	67
α-helix	162-164	3
β-strand	165-166	2	68
α-helix	173-175	3
β-strand	178-189	12	68
α-helix	190-192	3
β-strand	193-203	11	69
β-strand	208-213	6	69
α-helix	229-232	4
β-strand	234	1	70
β-strand	240	1	70
β-strand	241-243	3	69
β-strand	249-253	5	69
β-strand	254-259	6	68
α-helix	260-261	2
α-helix	270-271	2
β-strand	273-278	6	68
α-helix	280-282	3
β-strand	291-301	11	68
β-strand	318-330	13	68
α-helix	337-338	2
α-helix	344-354	11
α-helix	359-363	5
α-helix	375-386	12
β-strand	391-392	2	71
β-strand	398-399	2	71
β-strand	405-409	5	72
α-helix	415-425	11
β-strand	429-432	4	72
α-helix	439-442	4
β-strand	444-448	5	73
β-strand	455-459	5	73
α-helix	461-464	4
β-strand	468-472	5	72
α-helix	475-477	3
α-helix	480-491	12
β-strand	494-498	5	74
β-strand	503-507	5	74
β-strand	510-516	7	72
α-helix	529-533	5
α-helix	537-542	6
β-strand	545-549	5	72
α-helix	555-568	14
α-helix	581-583	3
β-strand	589-590	2	68
α-helix	653-665	13
β-strand	670	1	75
α-helix	673-687	15
α-helix	700-715	16
β-strand	720	1	75
α-helix	723-737	15

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA replication licensing factor MCM2	2, B	protein	868	Saccharomyces cerevisiae S288C	P29469 (AlphaFold model)
DNA replication licensing factor MCM3	3, C	protein	971	Saccharomyces cerevisiae S288C	P24279 (AlphaFold model)
DNA replication licensing factor MCM4	4, D	protein	933	Saccharomyces cerevisiae S288C	P30665 (AlphaFold model)
Minichromosome maintenance protein 5	5, E	protein	775	Saccharomyces cerevisiae S288C	P29496 (AlphaFold model)
DNA replication licensing factor MCM6	6, F	protein	1017	Saccharomyces cerevisiae S288C	P53091
DNA replication licensing factor MCM7	7, G	protein	845	Saccharomyces cerevisiae S288C	P38132

Sequence of entity 1 (2, B), FASTA

>7W8G_1 DNA replication licensing factor MCM2 (chains 2, B)
MSDNRRRRREEDDSDSENELPPSSPQQHFRGGMNPVSSPIGSPDMINPEGDDNEVDDVPD
IDEVEEQMNEVDLMDDNMYEDYAADHNRDRYDPDQVDDREQQELSLSERRRIDAQLNERD
RLLRNVAYIDDEDEEQEGAAQLDEMGLPVQRRRRRRQYEDLENSDDDLLSDMDIDPLREE
LTLESLSNVKANSYSEWITQPNVSRTIARELKSFLLEYTDETGRSVYGARIRTLGEMNSE
SLEVNYRHLAESKAILALFLAKCPEEMLKIFDLVAMEATELHYPDYARIHSEIHVRISDF
PTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIR
ISFCTNCKSKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKP
GEEVEVTGIYKNNYDGNLNAKNGFPVFATIIEANSIKRREGNTANEGEEGLDVFSWTEEE
EREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVL
LLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLAD
KGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNST
LPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELK
NNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQ
MDMDKVSRVYADLRRESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKV
VVDSFVDAQKVSVRRQLRRSFAIYTLGH

Sequence of entity 2 (3, C), FASTA

>7W8G_2 DNA replication licensing factor MCM3 (chains 3, C)
MEGSTGFDGDATTFFAPDAVFGDRVRRFQEFLDTFTSYRDSVRSIQVYNSNNAANYNDDQ
DDADERDLLGDDDGDDLEKEKKAASSTSLNILPHRIIISLDDLREFDRSFWSGILVEPAY
FIPPAEKALTDLADSMDDVPHPNASAVSSRHPWKLSFKGSFGAHALSPRTLTAQHLNKLV
SVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTPAIYPTEDTEGNK
LTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKPGDRVNVVGVFKS
LGAGGMNQSNSNTLIGFKTLILGNTVYPLHARSTGVAARQMLTDFDIRNINKLSKKKDIF
DILSQSLAPSIYGHDHIKKAILLMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLR
FVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGVVCIDEFDKMTD
VDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLL
SRFDLLFVVTDDINEIRDRSISEHVLRTHRYLPPGYLEGEPVRERLNLSLAVGEDADINP
EEHSNSGAGVENEGEDDEDHVFEKFNPLLQAGAKLAKNKGNYNGTEIPKLVTIPFLRKYV
QYAKERVIPQLTQEAINVIVKNYTDLRNDDNTKKSPITARTLETLIRLATAHAKVRLSKT
VNKVDAKVAANLLRFALLGEDIGNDIDEEESEYEEALSKRSPQKSPKKRQRVRQPASNSG
SPIKSTPRRSTASSVNATPSSARRILRFQDDEQNAGEDDNDIMSPLPADEEAELQRRLQL
GLRVSPRRREHLHAPEEGSSGPLTEVGTPRLPNVSSAGQDDEQQQSVISFDNVEPGTIST
GRLSLISGIIARLMQTEIFEEESYPVASLFERINEELPEEEKFSAQEYLAGLKIMSDRNN
LMVADDKVWRV

Sequence of entity 3 (4, D), FASTA

>7W8G_3 DNA replication licensing factor MCM4 (chains 4, D)
MSQQSSSPTKEDNNSSSPVVPNPDSVPPQLSSPALFYSSSSSQGDIYGRNNSQNLSQGEG
NIRAAIGSSPLNFPSSSQRQNSDVFQSQGRQGRIRSSASASGRSRYHSDLRSDRALPTSS
SSLGRNGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNTLDTSSSSAPPSEASEPLRII
WGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSN
LNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKF
YKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEI
DRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVY
DELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTST
IEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGI
LLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVG
LTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAG
IITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDREL
AKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKM
GDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDP
KTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVES
SDIQEALSRLQQEDKVIVLGEGVRRSVRLNNRV

Sequence of entity 4 (5, E), FASTA

>7W8G_4 Minichromosome maintenance protein 5 (chains 5, E)
MSFDRPEIYSAPVLQGESPNDDDNTEIIKSFKNFILEFRLDSQFIYRDQLRNNILVKNYS
LTVNMEHLIGYNEDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENT
SMDTDSLLLNSLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLS
IMCRNCRHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDP
YIIIHESSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIYSI
YNSKNGAGSGRSGGGNGGSGVAIRTPYIKILGIQSDVETSSIWNSVTMFTEEEEEEFLQL
SRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLLGDPGT
AKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCID
EFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNI
DFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGSEISIEKMK
RYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEAIIRIT
ESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGLNQASGTSLSEIRRFEQELKR
RLPIGWSTSYQTLRREFVDTHRFSQLALDKALYALEKHETIQLRHQGQNIYRSGV

Sequence of entity 5 (6, F), FASTA

>7W8G_5 DNA replication licensing factor MCM6 (chains 6, F)
MSSPFPADTPSSNRPSNSSPPPSSIGAGFGSSSGLDSQIGSRLHFPSSSQPHVSNSQTGP
FVNDSTQFSSQRLQTDGSATNDMEGNEPARSFKSRALNHVKKVDDVTGEKVREAFEQFLE
DFSVQSTDTGEVEKVYRAQIEFMKIYDLNTIYIDYQHLSMRENGALAMAISEQYYRFLPF
LQKGLRRVVRKYAPELLNTSDSLKRSEGDEGQADEDEQQDDDMNGSSLPRDSGSSAAPGN
GTSAMATRSITTSTSPEQTERVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEV
RPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVR
IQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSST
LDTRGISKTTEGLNSGVTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRET
ELQMAANLQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGH
EAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSG
KASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQT
ISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCN
EKIDTELASHIVDLHMKRDEAIEPPFSAEQLRRYIKYARTFKPILTKEARSYLVEKYKEL
RKDDAQGFSRSSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDV
DDVEMDEEFDNIESQSHAASGNNDDNDDGTGSGVITSEPPADIEEGQSEATARPGTSEKK
KTTVTYDKYVSMMNMIVRKIAEVDREGAEELTAVDIVDWYLLQKENDLGSLAEYWEERRL
AFKVIKRLVKDRILMEIHGTRHNLRDLENEENENNKTVYVIHPNCEVLDQLEPQDSS

Sequence of entity 6 (7, G), FASTA

>7W8G_6 DNA replication licensing factor MCM7 (chains 7, G)
MSAALPSIQLPVDYNNLFNEITDFLVTFKQDTLSSDATRNENEDENLDAENIEQHLLEKG
PKYMAMLQKVANRELNSVIIDLDDILQYQNEKFLQGTQADDLVSAIQQNANHFTELFCRA
IDNNMPLPTKEIDYKDDVLDVILNQRRLRNERMLSDRTNEIRSENLMDTTMDPPSSMNDA
LREVVEDETELFPPNLTRRYFLYFKPLSQNCARRYRKKAISSKPLSVRQIKGDFLGQLIT
VRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSECTSEECSQNQTKGQLFM
STRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPGDIVDVTGIFLPAPY
TGFKALKAGLLTETYLEAQFVRQHKKKFASFSLTSDVEERVMELITSGDVYNRLAKSIAP
EIYGNLDVKKALLLLLVGGVDKRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRG
VYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEV
MEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRLSPLDNINLPAALLSRFDILFLM
LDIPSRDDDEKLAEHVTYVHMHNKQPDLDFTPVEPSKMREYIAYAKTKRPVMSEAVNDYV
VQAYIRLRQDSKREMDSKFSFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLV
RVSKESLYQETNKSKEDESPTTKIFTIIKKMLQETGKNTLSYENIVKTVRLRGFTMLQLS
NCIQEYSYLNVWHLINEGNTLKFVDDGTMDTDQEDSLVSTPKLAPQTTASANVSAQDSDI
DLQDA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	10
MG	Magnesium ion	Mg	12
AGS	Phosphothiophosphoric acid-adenylate ester	C10 H16 N5 O12 P3 S	10
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Primary citation

Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase. Cheng, J., Li, N., Huo, Y. et al. Nat Commun (2022) 13:1396-1396. DOI 10.1038/s41467-022-29070-5 · PubMed

Other PDB entries of the same protein (UniProt P29469 (AlphaFold model), which also has an AlphaFold model), best resolution first:

28VY 2.7 Å, sCMGE assembled on ARS1 DNA with Sld2 and RPA
8RIF 2.79 Å, Cryo-EM structure of the MCM double hexamer loaded onto dsDNA.
7V3V 2.9 Å, Cryo-EM structure of MCM double hexamer bound with DDK in State I
9TH8 2.9 Å, Cryo-EM structure of MCM2-7 DH bound to Sld3-Sld7, Cdc45 and DNA
7P30 3.0 Å, 3.0 A resolution structure of a DNA-loaded MCM double hexamer
8KG6 3.07 Å, Yeast replisome in state I
9RHL 3.1 Å, Phospho-DH bound by Sld3-MBD on ARS1 DNA
7PMK 3.2 Å, S. cerevisiae replisome-SCF(Dia2) complex bound to double-stranded DNA (conformation I)
7PMN 3.2 Å, S. cerevisiae replisome-SCF(Dia2) complex bound to double-stranded DNA (conformation II)
7PT6 3.2 Å, Structure of MCM2-7 DH complexed with Cdc7-Dbf4 in the presence of ATPgS, state III
7V3U 3.2 Å, Cryo-EM structure of MCM double hexamer with structured Mcm4-NSD
9E2Y 3.2 Å, Cryo-EM structure of yeast CMG helicase stalled at G4-containing DNA template, state 3

Browse structure collections

About this viewer

MolViewer shows 7W8G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.