7Z7E: P63 DNA binding domain

Crystal structure of p63 DNA binding domain in complex with inhibitory DARPin G4. Determined by X-ray diffraction at 1.8 Å resolution. Released 29 Jun 2022.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 2,866
Mol. weight: 39.73 kDa
Ligands: ZN
Released: 29 Jun 2022

Explore 7Z7E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Z7E contains 17 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	128-129	2
β-strand	133	1	1
α-helix	135-137	3
β-strand	140-142	3	2
β-strand	155-157	3	1
β-strand	162-165	4	1
β-strand	171-176	6	2
α-helix	180-182	3
β-strand	186-193	8	1
α-helix	196-198	3
α-helix	202-203	2
α-helix	207-211	5
β-strand	227-230	4	2
β-strand	236-239	4	1
β-strand	246-251	6	1
β-strand	262-268	7	2
β-strand	283-290	8	1
β-strand	296-306	11	1
α-helix	310-319	10

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	3-14	12
α-helix	17-25	9
α-helix	40-47	8
α-helix	50-58	9
α-helix	73-80	8
α-helix	83-91	9
α-helix	106-113	8
α-helix	116-124	9
α-helix	139-145	7
α-helix	149-157	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 4 of Tumor protein 63	A	protein	204	Homo sapiens	Q9H3D4 (AlphaFold model)
Darpin	B	protein	159	synthetic construct

Sequence of entity 1 (A), FASTA

>7Z7E_1 Isoform 4 of Tumor protein 63 (chains A)
GSSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPP
PQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDP
ITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRC
FEARICACPGRDRKADEDSIRKQQ

Sequence of entity 2 (B), FASTA

>7Z7E_2 DARPIN (chains B)
GSDLGKKLLEAARAGQDDEVRILMANGADVNAADHSGDTPLHLAAMEGHLEIVEVLLKTG
ADVNAHDLEGYTPLHLAAYHGHLEIVEVLLKAGADVNAWDSYGYTPLHLAAMTGHLEIVE
VLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Designed Ankyrin Repeat Proteins as a tool box for analyzing p63. Strubel, A., Munick, P., Chaikuad, A. et al. Cell Death Differ (2022) 29:2445-2458. DOI 10.1038/s41418-022-01030-y · PubMed

Other PDB entries of the same protein (UniProt Q9H3D4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Y9U 1.6 Å, Structural basis of p63a SAM domain mutants involved in AEC syndrome
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
7Z72 1.8 Å, Crystal structure of p63 SAM in complex with darpin A5
7Z71 1.85 Å, Crystal structure of p63 DBD in complex with darpin C14
3ZY0 1.9 Å, Crystal structure of a truncated variant of the human p63 tetramerization domain lacking…
6RU8 1.92 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with triple phosphorylated…
6RU6 2.05 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with monophosphorylated p63…
6RU7 2.08 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with double phosphorylated…
3ZY1 2.15 Å, Crystal structure of the human p63 tetramerization domain
9N54 2.2 Å, Bipartite p63 NLS in complex with Importin Alpha 2
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
7Z73 2.27 Å, Crystal structure of p63 tetramerization domain in complex with darpin 8F1

Browse structure collections

About this viewer

MolViewer shows 7Z7E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.