8AS4: Human beta-arrestin-1

Crystal structure of human beta-arrestin-1. Determined by X-ray diffraction at 2.3 Å resolution. Released 7 Jun 2023.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,892
Mol. weight: 94.24 kDa
Released: 7 Jun 2023

Explore 8AS4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8AS4 contains 26 α-helices and 54 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	18-22	5	1
β-strand	26-29	4	2
β-strand	34	1	2
β-strand	37-43	7	1
α-helix	45-48	4
β-strand	52-63	12	3
β-strand	75-87	13	3
α-helix	90	1
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-117	6	1
α-helix	124-126	3
β-strand	127-130	4	3
β-strand	140-151	12	3
α-helix	157-159	3
α-helix	160-162	3
β-strand	163-166	4	3
β-strand	169-172	4	2
α-helix	181-184	4
β-strand	185-189	5	4
β-strand	197-203	7	4
β-strand	207-209	3	5
β-strand	214-222	9	4
β-strand	228-241	14	6
β-strand	247-258	12	6
β-strand	262	1	6
β-strand	266-274	9	4
α-helix	278-281	4
β-strand	287-289	3	3
β-strand	300	1	3
α-helix	301-305	5
α-helix	313-315	3
β-strand	317-329	13	6
α-helix	330	1
β-strand	341-349	9	6
β-strand	350-352	3	5
α-helix	353-356	4
β-strand	387-390	4	1

Chain B: 13 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	7
β-strand	18-22	5	7
β-strand	26-29	4	8
β-strand	34	1	8
β-strand	37-43	7	7
α-helix	45-48	4
β-strand	52-63	12	9
β-strand	71	1	10
β-strand	74	1	10
β-strand	75-87	13	9
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-117	6	7
α-helix	124-126	3
β-strand	127-130	4	9
α-helix	136-138	3
β-strand	140-151	12	9
α-helix	157-159	3
α-helix	160-162	3
β-strand	163-166	4	9
β-strand	169-172	4	8
α-helix	181-184	4
β-strand	185-189	5	11
β-strand	197-203	7	11
β-strand	207-209	3	12
β-strand	214-222	9	11
β-strand	228-241	14	13
β-strand	247-258	12	13
β-strand	262	1	13
β-strand	266-274	9	11
α-helix	278-281	4
β-strand	287-289	3	9
β-strand	300	1	9
α-helix	301-305	5
α-helix	313-315	3
β-strand	317-329	13	13
α-helix	330	1
β-strand	343-349	7	13
β-strand	350-352	3	12
α-helix	353-355	3
β-strand	386-390	5	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A, B	protein	418	Homo sapiens	P49407 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8AS4_1 Beta-arrestin-1 (chains A, B)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFLAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
IVLFNTAQYKVPVAMEEADDTVAPSSTFSKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR

Primary citation

A key GPCR phosphorylation motif discovered in arrestin2⋅CCR5 phosphopeptide complexes. Isaikina, P., Petrovic, I., Jakob, R.P. et al. Mol Cell (2023) 83:2108. DOI 10.1016/j.molcel.2023.05.002 · PubMed

Other PDB entries of the same protein (UniProt P49407 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
8ZYU 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
2IV8 2.8 Å, beta appendage in complex with b-arrestin peptide
8ZYY 2.83 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
9UYN 2.9 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to beta-arrestin 1 in…
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9LXR 3.07 Å, A Cryo-EM structure of LA-PTH-PTH1R-Beta-arrestin1 complex (state 1 conformation)
9LY2 3.1 Å, A Cryo-EM structure of LA-PTH-PTH1R-V2RT-Beta-arrestin1 complex (state 1 conformation)
9MBA 3.14 Å, Cryo-EM structure of complex of transducer-bound GPCR
25GN 3.2 Å, receptor-arrestin
8AS2 3.2 Å, Structure of arrestin2 in complex with 4P CCR5 phosphopeptide and Fab30

Browse structure collections

About this viewer

MolViewer shows 8AS4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.