8AUK: Human BIRC6

Cryo-EM structure of human BIRC6 in complex with HTRA2. Determined by electron microscopy at 6.2 Å resolution. Released 15 Feb 2023.

Method: Electron microscopy
Resolution: 6.2 Å
Organism: Homo sapiens
Chains: 5
Atoms: 47,811
Mol. weight: 1169.15 kDa
Ligands: ZN
Released: 15 Feb 2023

Explore 8AUK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8AUK contains 324 α-helices and 214 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 150 helices, 85 β-strands

Element	Residues	Length	Sheet
β-strand	57-64	8	1
β-strand	70-72	3	2
β-strand	75-76	2	2
β-strand	81-86	6	2
β-strand	91-95	5	2
β-strand	101-105	5	2
α-helix	109-110	2
β-strand	116-120	5	3
β-strand	125-129	5	3
β-strand	134-137	4	3
β-strand	139-140	2	4
β-strand	143-144	2	4
α-helix	151-154	4
β-strand	160-165	6	5
α-helix	167-175	9
α-helix	176-180	5
α-helix	189-207	19
α-helix	211-216	6
β-strand	219-224	6	5
α-helix	225-241	17
α-helix	248-262	15
α-helix	264-266	3
α-helix	280-283	4
β-strand	285	1	6
α-helix	286-291	6
α-helix	292-295	4
α-helix	306-311	6
β-strand	314-316	3	7
β-strand	326-328	3	7
α-helix	344-351	8
α-helix	356-359	4
β-strand	366	1	6
α-helix	368-373	6
β-strand	388-392	5	8
β-strand	400-404	5	8
β-strand	408-412	5	8
β-strand	420-425	6	8
α-helix	431-440	10
β-strand	503-513	11	9
β-strand	564	1	10
β-strand	566-577	12	9
β-strand	623-634	12	9
α-helix	637-638	2
α-helix	710-712	3
β-strand	716-721	6	9
α-helix	724-728	5
β-strand	731-738	8	11
β-strand	744-751	8	11
α-helix	752-754	3
β-strand	824-829	6	11
β-strand	830-831	2	12
β-strand	836	1	10
β-strand	838-839	2	12
β-strand	845-848	4	11
α-helix	852-854	3
β-strand	858-862	5	13
α-helix	863	1
α-helix	864-868	5
β-strand	902-906	5	13
β-strand	912-916	5	13
β-strand	922-926	5	13
α-helix	927-929	3
β-strand	930	1	14
α-helix	931	1
β-strand	937	1	14
β-strand	942-946	5	1
β-strand	951-955	5	1
β-strand	960-966	7	1
α-helix	1019-1029	11
β-strand	1031-1033	3	15
β-strand	1039-1041	3	16
β-strand	1046-1047	2	15
β-strand	1075-1079	5	15
α-helix	1080	1
β-strand	1088-1094	7	16
β-strand	1101-1110	10	15
β-strand	1120-1126	7	16
α-helix	1127-1131	5
α-helix	1172-1176	5
α-helix	1178-1180	3
β-strand	1181	1	16
β-strand	1186-1187	2	16
α-helix	1188-1190	3
β-strand	1192	1	15
β-strand	1198-1203	6	15
α-helix	1206-1212	7
β-strand	1219-1226	8	16
α-helix	1292-1295	4
β-strand	1296-1306	11	15
α-helix	1314-1323	10
α-helix	1326-1336	11
α-helix	1343-1345	3
α-helix	1346-1363	18
α-helix	1372-1383	12
α-helix	1385-1393	9
α-helix	1398-1413	16
α-helix	1422-1423	2
α-helix	1424-1434	11
α-helix	1435-1441	7
α-helix	1445-1458	14
α-helix	1464-1481	18
α-helix	1487-1496	10
α-helix	1552-1556	5
β-strand	1564-1565	2	17
β-strand	1569-1572	4	18
β-strand	1578-1581	4	19
α-helix	1759-1769	11
α-helix	1772-1775	4
β-strand	1776-1779	4	19
β-strand	1789-1800	12	18
β-strand	1803-1806	4	17
β-strand	1812-1820	9	18
α-helix	1824-1827	4
β-strand	1829-1834	6	18
β-strand	1842-1845	4	17
β-strand	1852-1862	11	18
α-helix	1863	1
β-strand	1872-1874	3	19
β-strand	1877-1880	4	17
α-helix	1886-1889	4
α-helix	1907-1909	3
α-helix	1910-1939	30
α-helix	1949-1954	6
α-helix	1965-1998	34
α-helix	2011-2016	6
α-helix	2020-2039	20
α-helix	2045-2047	3
α-helix	2048-2053	6
α-helix	2056-2066	11
α-helix	2072-2086	15
α-helix	2092-2103	12
α-helix	2114-2128	15
α-helix	2133-2145	13
α-helix	2147-2149	3
α-helix	2165-2188	24
α-helix	2325-2340	16
α-helix	2348-2364	17
α-helix	2368-2369	2
α-helix	2371-2373	3
α-helix	2377-2388	12
α-helix	2395-2397	3
α-helix	2401-2419	19
α-helix	2570-2573	4
α-helix	2577-2599	23
α-helix	2636-2649	14
α-helix	2650-2652	3
α-helix	2657-2669	13
α-helix	2690-2692	3
α-helix	2698-2710	13
α-helix	2716-2731	16
α-helix	2748-2754	7
α-helix	2757-2767	11
α-helix	2783-2799	17
α-helix	2805-2819	15
α-helix	2825-2828	4
α-helix	2833-2845	13
α-helix	2853-2872	20
β-strand	2877-2880	4	20
α-helix	2915-2930	16
β-strand	2933	1	21
α-helix	2934-2935	2
β-strand	2979	1	21
α-helix	2980-2986	7
α-helix	2988-2999	12
α-helix	3032-3046	15
α-helix	3051-3063	13
α-helix	3079-3088	10
α-helix	3092-3100	9
α-helix	3103-3117	15
α-helix	3119-3120	2
α-helix	3125-3131	7
β-strand	3161-3162	2	20
β-strand	3168-3170	3	20
α-helix	3179-3183	5
β-strand	3197-3200	4	20
β-strand	3207-3227	21	20
α-helix	3232-3234	3
β-strand	3238-3244	7	20
β-strand	3251-3252	2	20
α-helix	3256	1
β-strand	3257-3258	2	20
β-strand	3265-3283	19	20
α-helix	3284-3285	2
β-strand	3290-3301	12	20
α-helix	3321-3324	4
α-helix	3327-3339	13
α-helix	3345-3351	7
α-helix	3358-3366	9
α-helix	3369-3372	4
α-helix	3375-3388	14
α-helix	3390-3401	12
α-helix	3429-3440	12
α-helix	3446-3466	21
α-helix	3484-3487	4
α-helix	3491-3506	16
α-helix	3513-3516	4
α-helix	3519-3530	12
α-helix	3537-3552	16
α-helix	3554-3561	8
α-helix	3607-3616	10
α-helix	3620-3628	9
α-helix	3631-3651	21
α-helix	3683-3693	11
α-helix	3697-3703	7
α-helix	3709-3720	12
α-helix	3753-3771	19
α-helix	3775-3790	16
α-helix	3803-3805	3
α-helix	3806-3814	9
α-helix	3819-3820	2
β-strand	3821-3827	7	22
α-helix	3847-3849	3
β-strand	3855-3861	7	22
β-strand	3865	1	23
α-helix	3866-3872	7
β-strand	3961-3968	8	22
β-strand	3982	1	23
α-helix	3983-3991	9
β-strand	4001-4012	12	22
α-helix	4065-4067	3
α-helix	4070-4076	7
α-helix	4079-4086	8
α-helix	4155-4164	10
α-helix	4170-4174	5
α-helix	4178-4189	12
α-helix	4212-4223	12
α-helix	4229-4241	13
α-helix	4243-4255	13
α-helix	4315-4331	17
α-helix	4358-4364	7
α-helix	4369-4378	10
α-helix	4391-4404	14
α-helix	4406-4412	7
α-helix	4433-4444	12
α-helix	4478-4495	18

Chain B: 152 helices, 88 β-strands

Element	Residues	Length	Sheet
β-strand	57-64	8	24
β-strand	70-72	3	25
β-strand	75-76	2	25
β-strand	81-86	6	25
β-strand	91-95	5	25
β-strand	101-105	5	25
α-helix	109-110	2
β-strand	116-120	5	26
β-strand	125-129	5	26
β-strand	134-137	4	26
β-strand	139-140	2	27
β-strand	143-144	2	27
α-helix	151-154	4
β-strand	160-165	6	28
α-helix	167-175	9
α-helix	176-180	5
α-helix	189-209	21
α-helix	211-216	6
β-strand	219-224	6	28
α-helix	225-241	17
α-helix	248-262	15
α-helix	264-266	3
α-helix	280-283	4
β-strand	285	1	29
α-helix	286-291	6
α-helix	292-295	4
α-helix	306-311	6
β-strand	314-316	3	30
β-strand	326-328	3	30
β-strand	335	1	30
α-helix	344-351	8
α-helix	356-359	4
β-strand	366	1	29
α-helix	368-373	6
α-helix	375-377	3
β-strand	378	1	26
α-helix	379	1
β-strand	388-392	5	31
β-strand	400-404	5	31
β-strand	408-412	5	31
β-strand	420-425	6	31
α-helix	431-439	9
β-strand	503-513	11	32
β-strand	564	1	33
β-strand	566-577	12	32
β-strand	623-634	12	32
α-helix	637-638	2
α-helix	710-712	3
β-strand	716-721	6	32
α-helix	724-728	5
β-strand	731-738	8	34
β-strand	744-751	8	34
α-helix	752-754	3
β-strand	824-829	6	34
β-strand	830-831	2	35
β-strand	836	1	33
β-strand	838-839	2	35
β-strand	845-848	4	34
α-helix	852-854	3
β-strand	858-862	5	36
α-helix	863	1
α-helix	864-868	5
β-strand	902-906	5	36
β-strand	912-916	5	36
β-strand	922-926	5	36
α-helix	927-929	3
β-strand	930	1	37
α-helix	931	1
β-strand	937	1	37
β-strand	940-946	7	24
β-strand	951-956	6	24
β-strand	960-966	7	24
α-helix	1019-1028	10
β-strand	1031-1033	3	38
β-strand	1039-1041	3	39
β-strand	1046-1047	2	38
β-strand	1075-1079	5	38
β-strand	1088-1094	7	39
β-strand	1101-1110	10	38
β-strand	1120-1126	7	39
α-helix	1127-1131	5
α-helix	1172-1176	5
α-helix	1178-1180	3
β-strand	1181	1	39
β-strand	1186-1187	2	39
α-helix	1188-1191	4
β-strand	1192	1	38
β-strand	1198-1203	6	38
α-helix	1206-1212	7
β-strand	1219-1226	8	39
α-helix	1292-1295	4
β-strand	1296-1306	11	38
α-helix	1314-1323	10
α-helix	1326-1336	11
α-helix	1346-1363	18
α-helix	1372-1383	12
α-helix	1385-1393	9
α-helix	1398-1413	16
α-helix	1422-1423	2
α-helix	1424-1434	11
α-helix	1435-1441	7
α-helix	1445-1458	14
α-helix	1464-1481	18
α-helix	1487-1496	10
α-helix	1552-1556	5
α-helix	1560-1562	3
β-strand	1564-1565	2	40
β-strand	1569-1572	4	41
β-strand	1578-1581	4	42
α-helix	1759-1769	11
α-helix	1772-1775	4
β-strand	1776-1779	4	42
β-strand	1788-1800	13	41
β-strand	1803	1	40
β-strand	1804-1806	3	43
β-strand	1812-1820	9	41
β-strand	1829-1834	6	41
β-strand	1842-1844	3	43
β-strand	1852-1862	11	41
α-helix	1863	1
β-strand	1872-1874	3	42
β-strand	1879-1880	2	40
α-helix	1884-1885	2
α-helix	1886-1889	4
α-helix	1907-1909	3
α-helix	1910-1940	31
α-helix	1949-1954	6
α-helix	1965-1998	34
α-helix	2011-2016	6
α-helix	2020-2040	21
α-helix	2045-2047	3
α-helix	2048-2053	6
α-helix	2056-2066	11
α-helix	2072-2086	15
α-helix	2092-2103	12
α-helix	2114-2128	15
α-helix	2133-2145	13
α-helix	2147-2149	3
α-helix	2165-2188	24
α-helix	2325-2340	16
α-helix	2348-2364	17
α-helix	2368-2369	2
α-helix	2377-2388	12
α-helix	2395-2397	3
α-helix	2401-2419	19
α-helix	2570-2573	4
α-helix	2577-2599	23
α-helix	2636-2649	14
α-helix	2650-2652	3
α-helix	2657-2669	13
α-helix	2690-2692	3
α-helix	2698-2710	13
α-helix	2716-2731	16
α-helix	2748-2754	7
α-helix	2757-2767	11
α-helix	2783-2800	18
α-helix	2805-2819	15
α-helix	2825-2828	4
α-helix	2833-2844	12
α-helix	2853-2872	20
β-strand	2877-2880	4	44
α-helix	2915-2930	16
β-strand	2933	1	45
α-helix	2934-2935	2
β-strand	2979	1	45
α-helix	2980-2986	7
α-helix	2988-2999	12
α-helix	3032-3046	15
α-helix	3051-3063	13
α-helix	3079-3088	10
α-helix	3092-3100	9
α-helix	3103-3117	15
α-helix	3118-3120	3
α-helix	3125-3133	9
β-strand	3161-3162	2	44
β-strand	3168-3171	4	44
α-helix	3179-3183	5
β-strand	3197-3200	4	44
β-strand	3207-3227	21	44
α-helix	3232-3234	3
β-strand	3238-3244	7	44
β-strand	3251-3252	2	44
α-helix	3256	1
β-strand	3257-3258	2	44
β-strand	3265-3283	19	44
α-helix	3284-3285	2
β-strand	3290-3301	12	44
α-helix	3321-3324	4
α-helix	3327-3340	14
α-helix	3345-3352	8
α-helix	3358-3367	10
α-helix	3369-3371	3
α-helix	3375-3388	14
α-helix	3390-3401	12
α-helix	3429-3440	12
α-helix	3446-3466	21
α-helix	3484-3487	4
α-helix	3491-3506	16
α-helix	3513-3516	4
α-helix	3519-3529	11
α-helix	3537-3552	16
α-helix	3554-3561	8
α-helix	3607-3616	10
α-helix	3620-3628	9
α-helix	3631-3651	21
α-helix	3683-3693	11
α-helix	3697-3703	7
α-helix	3709-3720	12
α-helix	3753-3770	18
α-helix	3775-3790	16
α-helix	3803-3805	3
α-helix	3806-3814	9
α-helix	3819-3820	2
β-strand	3821-3827	7	46
α-helix	3847-3849	3
β-strand	3855-3861	7	46
β-strand	3865	1	47
α-helix	3866-3872	7
β-strand	3961-3968	8	46
α-helix	3976-3978	3
β-strand	3982	1	47
α-helix	3983-3992	10
β-strand	4001-4012	12	46
α-helix	4065-4067	3
α-helix	4070-4076	7
α-helix	4079-4086	8
α-helix	4155-4166	12
α-helix	4170-4174	5
α-helix	4178-4189	12
α-helix	4212-4223	12
α-helix	4229-4241	13
α-helix	4243-4255	13
α-helix	4315-4331	17
α-helix	4333-4335	3
α-helix	4359-4363	5
α-helix	4369-4378	10
α-helix	4391-4404	14
α-helix	4409-4412	4
α-helix	4433-4444	12
α-helix	4478-4495	18

Chain C: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	143-147	5
α-helix	149-157	9
β-strand	161-165	5	52
β-strand	181-186	6	52
β-strand	192-195	4	52
α-helix	197-200	4
β-strand	207-209	3	52
β-strand	215-224	10	52
β-strand	229-234	6	52
α-helix	239-241	3
α-helix	243-244	2
β-strand	245	1	53
α-helix	251-252	2
β-strand	256-259	4	53
β-strand	271-275	5	53
β-strand	295-297	3	53
α-helix	308	1
β-strand	309-312	4	53
β-strand	317-323	7	53
β-strand	330-334	5	53
α-helix	335-341	7

Chain D: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	143-146	4
α-helix	149-157	9
α-helix	158-160	3
β-strand	161-165	5	48
β-strand	182-188	7	48
β-strand	192-195	4	48
α-helix	197-200	4
β-strand	206-209	4	48
β-strand	215-224	10	48
β-strand	229-234	6	48
β-strand	245	1	49
α-helix	251-252	2
β-strand	257-259	3	49
β-strand	271-273	3	49
β-strand	275	1	49
β-strand	295-297	3	49
α-helix	308	1
β-strand	309-312	4	49
β-strand	317-324	8	49
β-strand	330-334	5	49
α-helix	335-339	5

Chain E: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	143-147	5
α-helix	149-157	9
α-helix	158-160	3
β-strand	161-165	5	50
β-strand	181-188	8	50
β-strand	192-195	4	50
α-helix	197-200	4
β-strand	205-209	5	50
β-strand	215-224	10	50
β-strand	229-234	6	50
α-helix	239-241	3
β-strand	245	1	51
α-helix	248-250	3
β-strand	257-259	3	51
β-strand	271-273	3	51
β-strand	275	1	51
β-strand	295-297	3	51
β-strand	309-312	4	51
β-strand	317-322	6	51
β-strand	330-334	5	51
α-helix	335-337	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral IAP repeat-containing protein 6	A, B	protein	4867	Homo sapiens	Q9NR09
Serine protease HTRA2, mitochondrial	C, D, E	protein	325	Homo sapiens	O43464 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8AUK_1 Baculoviral IAP repeat-containing protein 6 (chains A, B)
MVTGGGAAPPGTVTEPLPSVIVLSAGRKMAAAAAAASGPGCSSAAGAGAAGVSEWLVLRD
GCMHCDADGLHSLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALSAKPGGQVKCQYI
SAVDKVIFVDDYAVGCRKDLNGILLLDTALQTPVSKQDDVVQLELPVTEAQQLLSACLEK
VDISSTEGYDLFITQLKDGLKNTSHETAANHKVAKWATVTFHLPHHVLKSIASAIVNELK
KINQNVAALPVASSVMDRLSYLLPSARPELGVGPGRSVDRSLMYSEANRRETFTSWPHVG
YRWAQPDPMAQAGFYHQPASSGDDRAMCFTCSVCLVCWEPTDEPWSEHERHSPNCPFVKG
EHTQNVPLSVTLATSPAQFPCTDGTDRISCFGSGSCPHFLAAATKRGKICIWDVSKLMKV
HLKFEINAYDPAIVQQLILSGDPSSGVDSRRPTLAWLEDSSSCSDIPKLEGDSDDLLEDS
DSEEHSRSDSVTGHTSQKEAMEVSLDITALSILQQPEKLQWEIVANVLEDTVKDLEELGA
NPCLTNSKSEKTKEKHQEQHNIPFPCLLAGGLLTYKSPATSPISSNSHRSLDGLSRTQGE
SISEQGSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLHDD
GFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAAANLTSPDSEKWNSVFPKPGTLVQCL
RLPKFAEEENLCIDSITPCADGIHLLVGLRTCPVESLSAINQVEALNNLNKLNSALCNRR
KGELESNLAVVNGANISVIQHESPADVQTPLIIQPEQRNVSGGYLVLYKMNYATRIVTLE
EEPIKIQHIKDPQDTITSLILLPPDILDNREDDCEEPIEDMQLTSKNGFEREKTSDISTL
GHLVITTQGGYVKILDLSNFEILAKVEPPKKEGTEEQDTFVSVIYCSGTDRLCACTKGGE
LHFLQIGGTCDDIDEADILVDGSLSKGIEPSSEGSKPLSNPSSPGISGVDLLVDQPFTLE
ILTSLVELTRFETLTPRFSATVPPCWVEVQQEQQQRRHPQHLHQQHHGDAAQHTRTWKLQ
TDSNSWDEHVFELVLPKACMVGHVDFKFVLNSNITNIPQIQVTLLKNKAPGLGKVNALNI
EVEQNGKPSLVDLNEEMQHMDVEESQCLRLCPFLEDHKEDILCGPVWLASGLDLSGHAGM
LTLTSPKLVKGMAGGKYRSFLIHVKAVNERGTEEICNGGMRPVVRLPSLKHQSNKGYSLA
SLLAKVAAGKEKSSNVKNENTSGTRKSENLRGCDLLQEVSVTIRRFKKTSISKERVQRCA
MLQFSEFHEKLVNTLCRKTDDGQITEHAQSLVLDTLCWLAGVHSNGPGSSKEGNENLLSK
TRKFLSDIVRVCFFEAGRSIAHKCARFLALCISNGKCDPCQPAFGPVLLKALLDNMSFLP
AATTGGSVYWYFVLLNYVKDEDLAGCSTACASLLTAVSRQLQDRLTPMEALLQTRYGLYS
SPFDPVLFDLEMSGSSCKNVYNSSIGVQSDEIDLSDVLSGNGKVSSCTAAEGSFTSLTGL
LEVEPLHFTCVSTSDGTRIERDDAMSSFGVTPAVGGLSSGTVGEASTALSSAAQVALQSL
SHAMASAEQQLQVLQEKQQQLLKLQQQKAKLEAKLHQTTAAAAAAASAVGPVHNSVPSNP
VAAPGFFIHPSDVIPPTPKTTPLFMTPPLTPPNEAVSVVINAELAQLFPGSVIDPPAVNL
AAHNKNSNKSRMNPLGSGLALAISHASHFLQPPPHQSIIIERMHSGARRFVTLDFGRPIL
LTDVLIPTCGDLASLSIDIWTLGEEVDGRRLVVATDISTHSLILHDLIPPPVCRFMKITV
IGRYGSTNARAKIPLGFYYGHTYILPWESELKLMHDPLKGEGESANQPEIDQHLAMMVAL
QEDIQCRYNLACHRLETLLQSIDLPPLNSANNAQYFLRKPDKAVEEDSRVFSAYQDCIQL
QLQLNLAHNAVQRLKVALGASRKMLSETSNPEDLIQTSSTEQLRTIIRYLLDTLLSLLHA
SNGHSVPAVLQSTFHAQACEELFKHLCISGTPKIRLHTGLLLVQLCGGERWWGQFLSNVL
QELYNSEQLLIFPQDRVFMLLSCIGQRSLSNSGVLESLLNLLDNLLSPLQPQLPMHRRTE
GVLDIPMISWVVMLVSRLLDYVATVEDEAAAAKKPLNGNQWSFINNNLHTQSLNRSSKGS
SSLDRLYSRKIRKQLVHHKQQLNLLKAKQKALVEQMEKEKIQSNKGSSYKLLVEQAKLKQ
ATSKHFKDLIRLRRTAEWSRSNLDTEVTTAKESPEIEPLPFTLAHERCISVVQKLVLFLL
SMDFTCHADLLLFVCKVLARIANATRPTIHLCEIVNEPQLERLLLLLVGTDFNRGDISWG
GAWAQYSLTCMLQDILAGELLAPVAAEAMEEGTVGDDVGATAGDSDDSLQQSSVQLLETI
DEPLTHDITGAPPLSSLEKDKEIDLELLQDLMEVDIDPLDIDLEKDPLAAKVFKPISSTW
YDYWGADYGTYNYNPYIGGLGIPVAKPPANTEKNGSQTVSVSVSQALDARLEVGLEQQAE
LMLKMMSTLEADSILQALTNTSPTLSQSPTGTDDSLLGGLQAANQTSQLIIQLSSVPMLN
VCFNKLFSMLQVHHVQLESLLQLWLTLSLNSSSTGNKENGADIFLYNANRIPVISLNQAS
ITSFLTVLAWYPNTLLRTWCLVLHSLTLMTNMQLNSGSSSAIGTQESTAHLLVSDPNLIH
VLVKFLSGTSPHGTNQHSPQVGPTATQAMQEFLTRLQVHLSSTCPQIFSEFLLKLIHILS
TERGAFQTGQGPLDAQVKLLEFTLEQNFEVVSVSTISAVIESVTFLVHHYITCSDKVMSR
SGSDSSVGARACFGGLFANLIRPGDAKAVCGEMTRDQLMFDLLKLVNILVQLPLSGNREY
SARVSVTTNTTDSVSDEEKVSGGKDGNGSSTSVQGSPAYVADLVLANQQIMSQILSALGL
CNSSAMAMIIGASGLHLTKHENFHGGLDAISVGDGLFTILTTLSKKASTVHMMLQPILTY
MACGYMGRQGSLATCQLSEPLLWFILRVLDTSDALKAFHDMGGVQLICNNMVTSTRAIVN
TARSMVSTIMKFLDSGPNKAVDSTLKTRILASEPDNAEGIHNFAPLGTITSSSPTAQPAE
VLLQATPPHRRARSAAWSYIFLPEEAWCDLTIHLPAAVLLKEIHIQPHLASLATCPSSVS
VEVSADGVNMLPLSTPVVTSGLTYIKIQLVKAEVASAVCLRLHRPRDASTLGLSQIKLLG
LTAFGTTSSATVNNPFLPSEDQVSKTSIGWLRLLHHCLTHISDLEGMMASAAAPTANLLQ
TCAALLMSPYCGMHSPNIEVVLVKIGLQSTRIGLKLIDILLRNCAASGSDPTDLNSPLLF
GRLNGLSSDSTIDILYQLGTTQDPGTKDRIQALLKWVSDSARVAAMKRSGRMNYMCPNSS
TVEYGLLMPSPSHLHCVAAILWHSYELLVEYDLPALLDQELFELLFNWSMSLPCNMVLKK
AVDSLLCSMCHVHPNYFSLLMGWMGITPPPVQCHHRLSMTDDSKKQDLSSSLTDDSKNAQ
APLALTESHLATLASSSQSPEAIKQLLDSGLPSLLVRSLASFCFSHISSSESIAQSIDIS
QDKLRRHHVPQQCNKMPITADLVAPILRFLTEVGNSHIMKDWLGGSEVNPLWTALLFLLC
HSGSTSGSHNLGAQQTSARSASLSSAATTGLTTQQRTAIENATVAFFLQCISCHPNNQKL
MAQVLCELFQTSPQRGNLPTSGNISGFIRRLFLQLMLEDEKVTMFLQSPCPLYKGRINAT
SHVIQHPMYGAGHKFRTLHLPVSTTLSDVLDRVSDTPSITAKLISEQKDDKEKKNHEEKE
KVKAENGFQDNYSVVVASGLKSQSKRAVSATPPRPPSRRGRTIPDKIGSTSGAEAANKII
TVPVFHLFHKLLAGQPLPAEMTLAQLLTLLYDRKLPQGYRSIDLTVKLGSRVITDPSLSK
TDSYKRLHPEKDHGDLLASCPEDEALTPGDECMDGILDESLLETCPIQSPLQVFAGMGGL
ALIAERLPMLYPEVIQQVSAPVVTSTTQEKPKDSDQFEWVTIEQSGELVYEAPETVAAEP
PPIKSAVQTMSPIPAHSLAAFGLFLRLPGYAEVLLKERKHAQCLLRLVLGVTDDGEGSHI
LQSPSANVLPTLPFHVLRSLFSTTPLTTDDGVLLRRMALEIGALHLILVCLSALSHHSPR
VPNSSVNQTEPQVSSSHNPTSTEEQQLYWAKGTGFGTGSTASGWDVEQALTKQRLEEEHV
TCLLQVLASYINPVSSAVNGEAQSSHETRGQNSNALPSVLLELLSQSCLIPAMSSYLRND
SVLDMARHVPLYRALLELLRAIASCAAMVPLLLPLSTENGEEEEEQSECQTSVGTLLAKM
KTCVDTYTNRLRSKRENVKTGVKPDASDQEPEGLTLLVPDIQKTAEIVYAATTSLRQANQ
EKKLGEYSKKAAMKPKPLSVLKSLEEKYVAVMKKLQFDTFEMVSEDEDGKLGFKVNYHYM
SQVKNANDANSAARARRLAQEAVTLSTSLPLSSSSSVFVRCDEERLDIMKVLITGPADTP
YANGCFEFDVYFPQDYPSSPPLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRPEEK
WNPQTSSFLQVLVSVQSLILVAEPYFNEPGYERSRGTPSGTQSSREYDGNIRQATVKWAM
LEQIRNPSPCFKEVIHKHFYLKRVEIMAQCEEWIADIQQYSSDKRVGRTMSHHAAALKRH
TAQLREELLKLPCPEGLDPDTDDAPEVCRATTGAEETLMHDQVKPSSSKELPSDFQLSAW
SHPQFEK

Sequence of entity 2 (C, D, E), FASTA

>8AUK_2 Serine protease HTRA2, mitochondrial (chains C, D, E)
AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLI
VTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQ
GEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNAGGPLVNL
DGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSI
LAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRT
QSQLAVQIRRGRETLTLYVTPEVTE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural basis for regulation of apoptosis and autophagy by the BIRC6/SMAC complex. Ehrmann, J.F., Grabarczyk, D.B., Heinke, M. et al. Science (2023) 379:1117-1123. DOI 10.1126/science.ade8873 · PubMed

Other PDB entries of the same protein (UniProt Q9NR09), best resolution first:

8E2E 1.98 Å, Cryo-EM structure of helical arch of BIRC6 (from local refinement 1)
3CEG 2.01 Å, Crystal structure of the UBC domain of baculoviral IAP repeat-containing protein 6
8E2D 2.07 Å, Cryo-EM structure of BIRC6 (consensus)
8E2H 2.3 Å, Cryo-EM structure of C-terminal arm of BIRC6 (from local refinement 4)
8E2F 2.47 Å, Cryo-EM structure of N-terminal arm of BIRC6 (from local refinement 2)
8E2G 2.99 Å, Cryo-EM structure of N-terminal arm (aa68-966) of BIRC6 (from local refinement 3)
8ATO 3.0 Å, Structure of the giant inhibitor of apoptosis, BIRC6 bound to the regulator SMAC
8E2I 3.04 Å, Cryo-EM structure of BIRC6/Smac
9QH5 3.09 Å, Consensus structure of UBA6-UbDha-BIRC6 trapped ternary complex (doubly loaded)
8E2K 3.21 Å, Cryo-EM structure of BIRC6/HtrA2-S306A
8ATM 3.3 Å, Structure of the giant inhibitor of apoptosis, BIRC6 (composite map)
8ATU 3.3 Å, Cryo-EM structure of human BIRC6

Browse structure collections

About this viewer

MolViewer shows 8AUK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.