8E2I: BIRC6/Smac

Cryo-EM structure of BIRC6/Smac. Determined by electron microscopy at 3.04 Å resolution. Released 15 Feb 2023.

Method: Electron microscopy
Resolution: 3.04 Å
Organism: Homo sapiens
Chains: 6
Atoms: 46,174
Mol. weight: 1122.38 kDa
Released: 15 Feb 2023

Explore 8E2I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8E2I contains 309 α-helices and 188 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 149 helices, 94 β-strands

Element	Residues	Length	Sheet
β-strand	73-76	4	1
β-strand	81-85	5	1
β-strand	90-95	6	1
β-strand	101-106	6	1
β-strand	116	1	2
β-strand	119-120	2	2
β-strand	125-129	5	2
β-strand	134-137	4	2
β-strand	140	1	3
β-strand	143	1	3
α-helix	151-154	4
β-strand	160-166	7	4
α-helix	167-175	9
α-helix	176-180	5
α-helix	189-203	15
α-helix	213-216	4
β-strand	218-224	7	4
α-helix	225-242	18
α-helix	248-262	15
α-helix	280-282	3
β-strand	285	1	5
α-helix	286-292	7
α-helix	293-295	3
α-helix	306-311	6
β-strand	314-316	3	6
β-strand	326-328	3	6
β-strand	334-335	2	6
α-helix	344-351	8
β-strand	366	1	5
α-helix	368-373	6
α-helix	375-377	3
β-strand	378	1	2
β-strand	388-390	3	7
β-strand	393	1	7
β-strand	394	1	8
β-strand	400-404	5	7
β-strand	408-413	6	7
β-strand	419-425	7	7
α-helix	431-436	6
β-strand	504-513	10	8
β-strand	566-574	9	8
β-strand	626-634	9	8
β-strand	716-721	6	8
α-helix	722-723	2
α-helix	725-729	5
β-strand	731-738	8	9
β-strand	745-751	7	9
β-strand	823-828	6	9
β-strand	845-849	5	9
β-strand	856	1	10
β-strand	902-903	2	11
β-strand	906	1	11
β-strand	907	1	10
β-strand	912-916	5	11
β-strand	921-926	6	11
β-strand	940-946	7	12
β-strand	951-956	6	12
β-strand	961-965	5	12
α-helix	1019-1028	10
β-strand	1031-1033	3	13
α-helix	1037-1038	2
β-strand	1039-1041	3	14
β-strand	1046-1048	3	13
α-helix	1051-1054	4
α-helix	1063-1066	4
α-helix	1070-1072	3
β-strand	1075-1079	5	13
α-helix	1080	1
β-strand	1089-1094	6	14
β-strand	1101-1109	9	13
β-strand	1120-1125	6	14
α-helix	1172-1176	5
α-helix	1178-1180	3
β-strand	1181-1187	7	14
α-helix	1188-1191	4
β-strand	1192	1	15
β-strand	1199	1	15
β-strand	1200-1203	4	13
α-helix	1206-1209	4
β-strand	1219-1226	8	14
α-helix	1292-1295	4
β-strand	1298-1306	9	13
α-helix	1307-1308	2
α-helix	1314-1323	10
α-helix	1325-1335	11
α-helix	1340-1342	3
α-helix	1346-1363	18
α-helix	1377-1383	7
α-helix	1385-1394	10
α-helix	1398-1413	16
α-helix	1421-1423	3
α-helix	1424-1436	13
α-helix	1439-1441	3
α-helix	1445-1458	14
α-helix	1463-1483	21
α-helix	1487-1491	5
α-helix	1492-1496	5
α-helix	1560-1562	3
β-strand	1564-1565	2	16
β-strand	1569-1573	5	17
β-strand	1578-1580	3	18
α-helix	1772-1775	4
β-strand	1777-1780	4	18
β-strand	1788-1794	7	17
β-strand	1800-1806	7	16
β-strand	1812-1820	9	17
α-helix	1824-1827	4
β-strand	1829-1834	6	17
β-strand	1842-1844	3	16
β-strand	1855-1862	8	17
α-helix	1863	1
β-strand	1871-1874	4	18
β-strand	1877-1881	5	16
α-helix	1886-1889	4
α-helix	1912-1940	29
α-helix	1950-1957	8
α-helix	1961-1997	37
α-helix	2012-2017	6
α-helix	2020-2039	20
α-helix	2056-2062	7
α-helix	2063-2067	5
α-helix	2072-2086	15
α-helix	2092-2104	13
α-helix	2114-2127	14
α-helix	2132-2146	15
α-helix	2165-2181	17
α-helix	2326-2341	16
β-strand	2347	1	19
α-helix	2348-2364	17
α-helix	2371-2374	4
α-helix	2377-2388	12
β-strand	2389	1	20
α-helix	2401-2419	19
α-helix	2569-2572	4
α-helix	2577-2598	22
α-helix	2636-2648	13
β-strand	2655	1	20
α-helix	2657-2668	12
α-helix	2698-2710	13
α-helix	2716-2730	15
α-helix	2748-2754	7
α-helix	2756-2767	12
β-strand	2777	1	21
α-helix	2782-2801	20
α-helix	2805-2820	16
α-helix	2825-2828	4
α-helix	2833-2843	11
β-strand	2852	1	22
α-helix	2853-2872	20
β-strand	2877-2878	2	23
α-helix	2886-2888	3
α-helix	2915-2930	16
α-helix	2932	1
β-strand	2933	1	24
β-strand	2934	1	25
β-strand	2940	1	22
β-strand	2941	1	25
β-strand	2979	1	24
α-helix	2980-2986	7
α-helix	2988-2999	12
α-helix	3032-3046	15
α-helix	3050-3061	12
α-helix	3065-3067	3
α-helix	3075-3077	3
α-helix	3079-3088	10
α-helix	3092-3100	9
α-helix	3103-3116	14
β-strand	3120	1	26
α-helix	3125-3132	8
β-strand	3161-3162	2	23
α-helix	3164-3166	3
β-strand	3168-3170	3	23
α-helix	3176-3178	3
α-helix	3180-3183	4
α-helix	3187-3189	3
β-strand	3197-3200	4	23
α-helix	3201-3202	2
β-strand	3207-3227	21	23
α-helix	3232-3234	3
β-strand	3238-3244	7	23
β-strand	3251-3252	2	23
α-helix	3256	1
β-strand	3257-3258	2	23
β-strand	3265-3283	19	23
α-helix	3284-3285	2
β-strand	3290-3301	12	23
α-helix	3306-3308	3
α-helix	3322-3325	4
α-helix	3328-3339	12
α-helix	3342-3352	11
α-helix	3358-3366	9
α-helix	3375-3387	13
α-helix	3390-3401	12
α-helix	3429-3440	12
α-helix	3446-3465	20
α-helix	3484-3487	4
α-helix	3491-3507	17
α-helix	3513-3516	4
α-helix	3519-3531	13
α-helix	3533	1
α-helix	3537-3552	16
α-helix	3554-3563	10
α-helix	3607-3616	10
α-helix	3620-3628	9
α-helix	3631-3644	14
α-helix	3680-3694	15
α-helix	3697-3703	7
α-helix	3709-3719	11
α-helix	3753-3771	19
α-helix	3775-3789	15
α-helix	3807-3815	9
β-strand	3821-3827	7	27
α-helix	3847-3849	3
β-strand	3855-3861	7	27
α-helix	3866-3871	6
β-strand	3966-3969	4	27
α-helix	3976	1
β-strand	3977	1	27
α-helix	3978	1
α-helix	3983-3992	10
α-helix	3995-3996	2
β-strand	4001-4007	7	27
α-helix	4064-4069	6
α-helix	4070-4076	7
α-helix	4079-4084	6
α-helix	4155-4164	10
α-helix	4170-4174	5
α-helix	4178-4188	11
β-strand	4193	1	28
β-strand	4199	1	28
α-helix	4200-4202	3
α-helix	4206-4208	3
α-helix	4212-4222	11
α-helix	4229-4241	13
α-helix	4243-4255	13
α-helix	4306-4331	26
α-helix	4359-4366	8
α-helix	4369-4377	9
α-helix	4382-4386	5
α-helix	4389-4403	15
α-helix	4409-4411	3
α-helix	4433-4454	22
α-helix	4478-4498	21

Chain B: 151 helices, 94 β-strands

Element	Residues	Length	Sheet
β-strand	75-76	2	29
β-strand	81-85	5	29
β-strand	91-95	5	29
β-strand	101-105	5	29
β-strand	116	1	30
β-strand	119-120	2	30
β-strand	125-129	5	30
β-strand	134-137	4	30
β-strand	139-140	2	31
β-strand	143-144	2	31
α-helix	151-154	4
β-strand	160-166	7	32
α-helix	167-175	9
α-helix	176-180	5
α-helix	189-203	15
α-helix	213-216	4
β-strand	218-224	7	32
α-helix	225-242	18
α-helix	248-262	15
α-helix	280-283	4
β-strand	285	1	33
α-helix	286-292	7
α-helix	293-295	3
α-helix	306-311	6
β-strand	314-316	3	34
β-strand	326-328	3	34
β-strand	334-335	2	34
α-helix	344-351	8
β-strand	366	1	33
α-helix	368-373	6
α-helix	375-377	3
β-strand	378	1	30
β-strand	388-390	3	35
β-strand	393	1	35
β-strand	394	1	36
β-strand	400-404	5	35
β-strand	408-413	6	35
α-helix	415-418	4
β-strand	419-425	7	35
α-helix	431-436	6
β-strand	504-513	10	36
β-strand	566-574	9	36
β-strand	626-634	9	36
β-strand	716-721	6	36
α-helix	722-723	2
α-helix	725-728	4
β-strand	731-738	8	37
β-strand	745-751	7	37
β-strand	823-828	6	37
β-strand	845-849	5	37
β-strand	856	1	38
β-strand	902-903	2	39
β-strand	906	1	39
β-strand	907	1	38
β-strand	912-916	5	39
β-strand	921-926	6	39
β-strand	940-945	6	40
β-strand	951-956	6	40
β-strand	961-965	5	40
α-helix	1019-1029	11
β-strand	1031-1033	3	41
α-helix	1037-1038	2
β-strand	1039-1041	3	42
β-strand	1046-1048	3	41
α-helix	1051-1054	4
α-helix	1061-1064	4
α-helix	1070-1073	4
β-strand	1074-1079	6	41
α-helix	1080	1
β-strand	1089-1094	6	42
β-strand	1101-1109	9	41
β-strand	1120-1126	7	42
α-helix	1172-1176	5
α-helix	1178-1180	3
β-strand	1181-1187	7	42
α-helix	1188-1191	4
β-strand	1192	1	41
β-strand	1199-1203	5	41
α-helix	1206-1209	4
β-strand	1219-1226	8	42
α-helix	1292-1295	4
β-strand	1298-1306	9	41
α-helix	1307-1308	2
α-helix	1314-1323	10
α-helix	1325-1335	11
α-helix	1340-1342	3
α-helix	1346-1363	18
α-helix	1377-1383	7
α-helix	1385-1394	10
α-helix	1398-1413	16
α-helix	1421-1423	3
α-helix	1424-1436	13
α-helix	1439-1441	3
α-helix	1445-1458	14
α-helix	1463-1483	21
α-helix	1487-1491	5
α-helix	1492-1496	5
β-strand	1564-1565	2	43
β-strand	1569-1573	5	44
β-strand	1578-1580	3	45
α-helix	1772-1775	4
β-strand	1777-1780	4	45
β-strand	1788-1794	7	44
β-strand	1800-1806	7	43
β-strand	1812-1820	9	44
α-helix	1824-1827	4
β-strand	1829-1834	6	44
β-strand	1842-1844	3	43
β-strand	1855-1862	8	44
α-helix	1863	1
β-strand	1871-1874	4	45
β-strand	1877-1881	5	43
α-helix	1886-1889	4
α-helix	1912-1940	29
α-helix	1950-1957	8
α-helix	1961-1997	37
α-helix	2012-2017	6
α-helix	2020-2039	20
α-helix	2056-2062	7
α-helix	2063-2067	5
α-helix	2072-2086	15
α-helix	2092-2104	13
α-helix	2114-2127	14
α-helix	2132-2146	15
α-helix	2147-2149	3
α-helix	2165-2181	17
α-helix	2326-2341	16
β-strand	2347	1	26
α-helix	2348-2364	17
α-helix	2371-2374	4
α-helix	2377-2388	12
β-strand	2389	1	46
β-strand	2394	1	47
β-strand	2397	1	47
α-helix	2401-2419	19
α-helix	2569-2572	4
α-helix	2577-2598	22
α-helix	2636-2648	13
β-strand	2655	1	46
α-helix	2657-2668	12
α-helix	2690-2692	3
α-helix	2698-2710	13
α-helix	2716-2730	15
α-helix	2748-2754	7
α-helix	2756-2767	12
β-strand	2777	1	23
α-helix	2782-2801	20
α-helix	2805-2820	16
α-helix	2825-2828	4
α-helix	2833-2844	12
β-strand	2852	1	48
α-helix	2853-2872	20
β-strand	2877-2879	3	21
α-helix	2886-2888	3
α-helix	2915-2930	16
α-helix	2932	1
β-strand	2933	1	49
β-strand	2934	1	50
β-strand	2940	1	48
β-strand	2941	1	50
β-strand	2979	1	49
α-helix	2980-2986	7
α-helix	2988-2999	12
α-helix	3032-3046	15
α-helix	3050-3061	12
α-helix	3065-3067	3
α-helix	3075-3077	3
α-helix	3079-3088	10
α-helix	3092-3100	9
α-helix	3103-3117	15
β-strand	3120	1	19
α-helix	3125-3132	8
β-strand	3161-3162	2	21
α-helix	3164-3166	3
β-strand	3168-3170	3	21
α-helix	3177-3178	2
α-helix	3180-3183	4
α-helix	3187-3189	3
β-strand	3197-3200	4	21
α-helix	3201-3202	2
β-strand	3207-3227	21	21
α-helix	3232-3234	3
β-strand	3238-3244	7	21
β-strand	3251-3252	2	21
α-helix	3256	1
β-strand	3257-3258	2	21
β-strand	3265-3283	19	21
α-helix	3284-3285	2
β-strand	3290-3301	12	21
α-helix	3306-3308	3
α-helix	3322-3325	4
α-helix	3328-3340	13
α-helix	3342-3352	11
α-helix	3358-3366	9
α-helix	3375-3386	12
α-helix	3390-3397	8
α-helix	3398-3402	5
α-helix	3429-3440	12
α-helix	3446-3465	20
α-helix	3484-3487	4
α-helix	3491-3507	17
α-helix	3513-3516	4
α-helix	3519-3531	13
α-helix	3533	1
α-helix	3537-3552	16
α-helix	3554-3564	11
α-helix	3607-3616	10
α-helix	3620-3629	10
α-helix	3631-3644	14
α-helix	3680-3694	15
α-helix	3697-3703	7
α-helix	3709-3719	11
α-helix	3753-3771	19
α-helix	3775-3789	15
α-helix	3807-3815	9
β-strand	3821-3827	7	51
α-helix	3847-3849	3
β-strand	3855-3861	7	51
α-helix	3866-3871	6
β-strand	3966-3969	4	51
α-helix	3976-3978	3
α-helix	3982-3992	11
α-helix	3995-3996	2
β-strand	4001-4007	7	51
α-helix	4064-4069	6
α-helix	4070-4076	7
α-helix	4079-4084	6
α-helix	4155-4164	10
α-helix	4170-4174	5
α-helix	4178-4188	11
β-strand	4193	1	52
β-strand	4199	1	52
α-helix	4200-4202	3
α-helix	4206-4208	3
α-helix	4212-4222	11
α-helix	4229-4241	13
α-helix	4243-4255	13
α-helix	4306-4331	26
α-helix	4360-4366	7
α-helix	4369-4377	9
α-helix	4382-4387	6
α-helix	4389-4403	15
α-helix	4409-4411	3
α-helix	4433-4454	22
α-helix	4478-4498	21

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	52-106	55

Chain E: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	13-64	52
α-helix	68-70	3
α-helix	71-119	49
α-helix	122-180	59

Chain F: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	13-64	52
α-helix	71-119	49
α-helix	122-180	59

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral IAP repeat-containing protein 6	A, B	protein	4888	Homo sapiens	Q9NR09
Diablo IAP-binding mitochondrial protein	E, F	protein	194	Homo sapiens	Q9NR28 (AlphaFold model)
Baculoviral IAP repeat-containing protein 6	C, D	protein	57	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>8E2I_1 Baculoviral IAP repeat-containing protein 6 (chains A, B)
MDYKDDDDKLAAANSSIDLISTSLYKKAGLTMVTGGGAAPPGTVTEPLPSVIVLSAGRKM
AAAAAAASGPGCSSAAGAGAAGVSEWLVLRDGCMHCDADGLHSLSYHPALNAILAVTSRG
TIKVIDGTSGATLQASALSAKPGGQVKCQYISAVDKVIFVDDYAVGCRKDLNGILLLDTA
LQTPVSKQDDVVQLELPVTEAQQLLSACLEKVDISSTEGYDLFITQLKDGLKNTSHETAA
NHKVAKWATVTFHLPHHVLKSIASAIVNELKKINQNVAALPVASSVMDRLSYLLPSARPE
LGVGPGRSVDRSLMYSEANRRETFTSWPHVGYRWAQPDPMAQAGFYHQPASSGDDRAMCF
TCSVCLVCWEPTDEPWSEHERHSPNCPFVKGEHTQNVPLSVTLATSPAQFPCTDGTDRIS
CFGSGSCPHFLAAATKRGKICIWDVSKLMKVHLKFEINAYDPAIVQQLILSGDPSSGVDS
RRPTLAWLEDSSSCSDIPKLEGDSDDLLEDSDSEEHSRSDSVTGHTSQKEAMEVSLDITA
LSILQQPEKLQWEIVANVLEDTVKDLEELGANPCLTNSKSEKTKEKHQEQHNIPFPCLLA
GGLLTYKSPATSPISSNSHRSLDGLSRTQGESISEQGSTDNESCTNSELNSPLVRRTLPV
LLLYSIKESDEKAGKIFSQMNNIMSKSLHDDGFTVPQIIEMELDSQEQLLLQDPPVTYIQ
QFADAAANLTSPDSEKWNSVFPKPGTLVQCLRLPKFAEEENLCIDSITPCADGIHLLVGL
RTCPVESLSAINQVEALNNLNKLNSALCNRRKGELESNLAVVNGANISVIQHESPADVQT
PLIIQPEQRNVSGGYLVLYKMNYATRIVTLEEEPIKIQHIKDPQDTITSLILLPPDILDN
REDDCEEPIEDMQLTSKNGFEREKTSDISTLGHLVITTQGGYVKILDLSNFEILAKVEPP
KKEGTEEQDTFVSVIYCSGTDRLCACTKGGELHFLQIGGTCDDIDEADILVDGSLSKGIE
PSSEGSKPLSNPSSPGISGVDLLVDQPFTLEILTSLVELTRFETLTPRFSATVPPCWVEV
QQEQQQRRHPQHLHQQHHGDAAQHTRTWKLQTDSNSWDEHVFELVLPKACMVGHVDFKFV
LNSNITNIPQIQVTLLKNKAPGLGKVNALNIEVEQNGKPSLVDLNEEMQHMDVEESQCLR
LCPFLEDHKEDILCGPVWLASGLDLSGHAGMLTLTSPKLVKGMAGGKYRSFLIHVKAVNE
RGTEEICNGGMRPVVRLPSLKHQSNKGYSLASLLAKVAAGKEKSSNVKNENTSGTRKSEN
LRGCDLLQEVSVTIRRFKKTSISKERVQRCAMLQFSEFHEKLVNTLCRKTDDGQITEHAQ
SLVLDTLCWLAGVHSNGPGSSKEGNENLLSKTRKFLSDIVRVCFFEAGRSIAHKCARFLA
LCISNGKCDPCQPAFGPVLLKALLDNMSFLPAATTGGSVYWYFVLLNYVKDEDLAGCSTA
CASLLTAVSRQLQDRLTPMEALLQTRYGLYSSPFDPVLFDLEMSGSSCKNVYNSSIGVQS
DEIDLSDVLSGNGKVSSCTAAEGSFTSLTGLLEVEPLHFTCVSTSDGTRIERDDAMSSFG
VTPAVGGLSSGTVGEASTALSSAAQVALQSLSHAMASAEQQLQVLQEKQQQLLKLQQQKA
KLEAKLHQTTAAAAAAASAVGPVHNSVPSNPVAAPGFFIHPSDVIPPTPKTTPLFMTPPL
TPPNEAVSVVINAELAQLFPGSVIDPPAVNLAAHNKNSNKSRMNPLGSGLALAISHASHF
LQPPPHQSIIIERMHSGARRFVTLDFGRPILLTDVLIPTCGDLASLSIDIWTLGEEVDGR
RLVVATDISTHSLILHDLIPPPVCRFMKITVIGRYGSTNARAKIPLGFYYGHTYILPWES
ELKLMHDPLKGEGESANQPEIDQHLAMMVALQEDIQCRYNLACHRLETLLQSIDLPPLNS
ANNAQYFLRKPDKAVEEDSRVFSAYQDCIQLQLQLNLAHNAVQRLKVALGASRKMLSETS
NPEDLIQTSSTEQLRTIIRYLLDTLLSLLHASNGHSVPAVLQSTFHAQACEELFKHLCIS
GTPKIRLHTGLLLVQLCGGERWWGQFLSNVLQELYNSEQLLIFPQDRVFMLLSCIGQRSL
SNSGVLESLLNLLDNLLSPLQPQLPMHRRTEGVLDIPMISWVVMLVSRLLDYVATVEDEA
AAAKKPLNGNQWSFINNNLHTQSLNRSSKGSSSLDRLYSRKIRKQLVHHKQQLNLLKAKQ
KALVEQMEKEKIQSNKGSSYKLLVEQAKLKQATSKHFKDLIRLRRTAEWSRSNLDTEVTT
AKESPEIEPLPFTLAHERCISVVQKLVLFLLSMDFTCHADLLLFVCKVLARIANATRPTI
HLCEIVNEPQLERLLLLLVGTDFNRGDISWGGAWAQYSLTCMLQDILAGELLAPVAAEAM
EEGTVGDDVGATAGDSDDSLQQSSVQLLETIDEPLTHDITGAPPLSSLEKDKEIDLELLQ
DLMEVDIDPLDIDLEKDPLAAKVFKPISSTWYDYWGADYGTYNYNPYIGGLGIPVAKPPA
NTEKNGSQTVSVSVSQALDARLEVGLEQQAELMLKMMSTLEADSILQALTNTSPTLSQSP
TGTDDSLLGGLQAANQTSQLIIQLSSVPMLNVCFNKLFSMLQVHHVQLESLLQLWLTLSL
NSSSTGNKENGADIFLYNANRIPVISLNQASITSFLTVLAWYPNTLLRTWCLVLHSLTLM
TNMQLNSGSSSAIGTQESTAHLLVSDPNLIHVLVKFLSGTSPHGTNQHSPQVGPTATQAM
QEFLTRLQVHLSSTCPQIFSEFLLKLIHILSTERGAFQTGQGPLDAQVKLLEFTLEQNFE
VVSVSTISAVIESVTFLVHHYITCSDKVMSRSGSDSSVGARACFGGLFANLIRPGDAKAV
CGEMTRDQLMFDLLKLVNILVQLPLSGNREYSARVSVTTNTTDSVSDEEKVSGGKDGNGS
STSVQGSPAYVADLVLANQQIMSQILSALGLCNSSAMAMIIGASGLHLTKHENFHGGLDA
ISVGDGLFTILTTLSKKASTVHMMLQPILTYMACGYMGRQGSLATCQLSEPLLWFILRVL
DTSDALKAFHDMGGVQLICNNMVTSTRAIVNTARSMVSTIMKFLDSGPNKAVDSTLKTRI
LASEPDNAEGIHNFAPLGTITSSSPTAQPAEVLLQATPPHRRARSAAWSYIFLPEEAWCD
LTIHLPAAVLLKEIHIQPHLASLATCPSSVSVEVSADGVNMLPLSTPVVTSGLTYIKIQL
VKAEVASAVCLRLHRPRDASTLGLSQIKLLGLTAFGTTSSATVNNPFLPSEDQVSKTSIG
WLRLLHHCLTHISDLEGMMASAAAPTANLLQTCAALLMSPYCGMHSPNIEVVLVKIGLQS
TRIGLKLIDILLRNCAASGSDPTDLNSPLLFGRLNGLSSDSTIDILYQLGTTQDPGTKDR
IQALLKWVSDSARVAAMKRSGRMNYMCPNSSTVEYGLLMPSPSHLHCVAAILWHSYELLV
EYDLPALLDQELFELLFNWSMSLPCNMVLKKAVDSLLCSMCHVHPNYFSLLMGWMGITPP
PVQCHHRLSMTDDSKKQDLSSSLTDDSKNAQAPLALTESHLATLASSSQSPEAIKQLLDS
GLPSLLVRSLASFCFSHISSSESIAQSIDISQDKLRRHHVPQQCNKMPITADLVAPILRF
LTEVGNSHIMKDWLGGSEVNPLWTALLFLLCHSGSTSGSHNLGAQQTSARSASLSSAATT
GLTTQQRTAIENATVAFFLQCISCHPNNQKLMAQVLCELFQTSPQRGNLPTSGNISGFIR
RLFLQLMLEDEKVTMFLQSPCPLYKGRINATSHVIQHPMYGAGHKFRTLHLPVSTTLSDV
LDRVSDTPSITAKLISEQKDDKEKKNHEEKEKVKAENGFQDNYSVVVASGLKSQSKRAVS
ATPPRPPSRRGRTIPDKIGSTSGAEAANKIITVPVFHLFHKLLAGQPLPAEMTLAQLLTL
LYDRKLPQGYRSIDLTVKLGSRVITDPSLSKTDSYKRLHPEKDHGDLLASCPEDEALTPG
DECMDGILDESLLETCPIQSPLQVFAGMGGLALIAERLPMLYPEVIQQVSAPVVTSTTQE
KPKDSDQFEWVTIEQSGELVYEAPETVAAEPPPIKSAVQTMSPIPAHSLAAFGLFLRLPG
YAEVLLKERKHAQCLLRLVLGVTDDGEGSHILQSPSANVLPTLPFHVLRSLFSTTPLTTD
DGVLLRRMALEIGALHLILVCLSALSHHSPRVPNSSVNQTEPQVSSSHNPTSTEEQQLYW
AKGTGFGTGSTASGWDVEQALTKQRLEEEHVTCLLQVLASYINPVSSAVNGEAQSSHETR
GQNSNALPSVLLELLSQSCLIPAMSSYLRNDSVLDMARHVPLYRALLELLRAIASCAAMV
PLLLPLSTENGEEEEEQSECQTSVGTLLAKMKTCVDTYTNRLRSKRENVKTGVKPDASDQ
EPEGLTLLVPDIQKTAEIVYAATTSLRQANQEKKLGEYSKKAAMKPKPLSVLKSLEEKYV
AVMKKLQFDTFEMVSEDEDGKLGFKVNYHYMSQVKNANDANSAARARRLAQEAVTLSTSL
PLSSSSSVFVRCDEERLDIMKVLITGPADTPYANGCFEFDVYFPQDYPSSPPLVNLETTG
GHSVRFNPNLYNDGKVCLSILNTWHGRPEEKWNPQTSSFLQVLVSVQSLILVAEPYFNEP
GYERSRGTPSGTQSSREYDGNIRQATVKWAMLEQIRNPSPCFKEVIHKHFYLKRVEIMAQ
CEEWIADIQQYSSDKRVGRTMSHHAAALKRHTAQLREELLKLPCPEGLDPDTDDAPEVCR
ATTGAEETLMHDQVKPSSSKELPSDFQL

Sequence of entity 2 (E, F), FASTA

>8E2I_2 Diablo IAP-binding mitochondrial protein (chains E, F)
MAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLY
RQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQT
GADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEA
YLREDHHHHHHHHH

Sequence of entity 3 (C, D), FASTA

>8E2I_3 Baculoviral IAP repeat-containing protein 6 (chains C, D)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Primary citation

Structures of BIRC6-client complexes provide a mechanism of SMAC-mediated release of caspases. Hunkeler, M., Jin, C.Y., Fischer, E.S. Science (2023) 379:1105-1111. DOI 10.1126/science.ade5750 · PubMed

Other PDB entries of the same protein (UniProt Q9NR09), best resolution first:

8E2E 1.98 Å, Cryo-EM structure of helical arch of BIRC6 (from local refinement 1)
3CEG 2.01 Å, Crystal structure of the UBC domain of baculoviral IAP repeat-containing protein 6
8E2D 2.07 Å, Cryo-EM structure of BIRC6 (consensus)
8E2H 2.3 Å, Cryo-EM structure of C-terminal arm of BIRC6 (from local refinement 4)
8E2F 2.47 Å, Cryo-EM structure of N-terminal arm of BIRC6 (from local refinement 2)
8E2G 2.99 Å, Cryo-EM structure of N-terminal arm (aa68-966) of BIRC6 (from local refinement 3)
8ATO 3.0 Å, Structure of the giant inhibitor of apoptosis, BIRC6 bound to the regulator SMAC
9QH5 3.09 Å, Consensus structure of UBA6-UbDha-BIRC6 trapped ternary complex (doubly loaded)
8E2K 3.21 Å, Cryo-EM structure of BIRC6/HtrA2-S306A
8ATM 3.3 Å, Structure of the giant inhibitor of apoptosis, BIRC6 (composite map)
8ATU 3.3 Å, Cryo-EM structure of human BIRC6
9XGB 3.3 Å, UBA6-BIRC6 ubc-ubt

Browse structure collections

About this viewer

MolViewer shows 8E2I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.