8FOI: Gamma-aminobutyric acid receptor subunit alpha-1

Native GABA-A receptor from the mouse brain, alpha1-beta2-gamma2 subtype, in complex with GABA and allopregnanolone. Determined by electron microscopy at 2.5 Å resolution. Released 20 Sept 2023.

Method: Electron microscopy
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 9
Atoms: 18,286
Mol. weight: 390.47 kDa
Ligands: PIO, D12, OCT, POV
Released: 20 Sept 2023

Explore 8FOI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FOI contains 74 α-helices and 122 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	12-22	11
β-strand	38-48	11	1
β-strand	52-53	2	1
β-strand	58-70	13	1
α-helix	72-74	3
β-strand	82-85	4	1
α-helix	87-92	6
β-strand	98-100	3	2
β-strand	103	1	1
β-strand	107-108	2	1
β-strand	112	1	3
β-strand	116-121	6	1
β-strand	125-137	13	1
β-strand	149-158	10	2
β-strand	166-170	5	1
α-helix	174-176	3
β-strand	178-180	3	1
β-strand	190-202	13	2
β-strand	209-220	12	2
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-242	12
α-helix	243-245	3
α-helix	251-273	23
α-helix	284-308	25
α-helix	386-389	4
α-helix	390-415	26

Chain B: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	7-20	14
α-helix	35	1
β-strand	36-51	16	4
β-strand	56-68	13	4
α-helix	70-72	3
β-strand	81-83	3	4
α-helix	85-90	6
β-strand	96-98	3	5
β-strand	101-106	6	4
β-strand	114-118	5	4
β-strand	123-135	13	4
α-helix	140-142	3
β-strand	147-156	10	5
β-strand	164-168	5	4
α-helix	171-173	3
β-strand	176	1	4
β-strand	186-200	15	5
β-strand	203-216	14	5
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-236	10
α-helix	237-241	5
α-helix	247-271	25
α-helix	280-307	28
α-helix	459-486	28

Chain C: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	10-22	13
α-helix	30	1
β-strand	38-48	11	6
β-strand	52-53	2	6
β-strand	58-70	13	6
α-helix	72-74	3
β-strand	82-85	4	6
α-helix	87-92	6
β-strand	98-100	3	7
β-strand	103	1	6
β-strand	107-108	2	6
β-strand	116-121	6	6
β-strand	125-137	13	6
β-strand	149-158	10	7
β-strand	166-170	5	6
α-helix	174-176	3
β-strand	178-180	3	6
α-helix	182-184	3
β-strand	190-202	13	7
β-strand	209-220	12	7
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-240	10
α-helix	241-245	5
α-helix	251-273	23
α-helix	284-308	25
α-helix	387-389	3
α-helix	390-415	26

Chain D: 11 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	26-35	10
α-helix	50	1
β-strand	51-57	7	8
β-strand	59-66	8	8
β-strand	71-83	13	8
α-helix	85-87	3
β-strand	95-98	4	8
α-helix	100-105	6
β-strand	111-113	3	9
β-strand	116-121	6	8
β-strand	125	1	7
β-strand	129-134	6	8
β-strand	138-149	12	8
β-strand	162-171	10	9
β-strand	179-188	10	8
α-helix	193-195	3
β-strand	201-215	15	9
β-strand	218-231	14	9
α-helix	234-236	3
α-helix	237-241	5
α-helix	242-256	15
α-helix	262-286	25
α-helix	295-318	24
α-helix	411-431	21

Chain E: 13 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	7-20	14
α-helix	28	1
α-helix	35	1
β-strand	36-41	6	10
β-strand	42-43	2	11
β-strand	44-51	8	10
β-strand	56-68	13	10
α-helix	70-72	3
β-strand	81-83	3	10
α-helix	85-90	6
β-strand	96-98	3	3
β-strand	101-106	6	10
β-strand	110	1	9
β-strand	114-118	5	10
β-strand	123-135	13	10
α-helix	140-142	3
β-strand	147-150	4	3
β-strand	153-156	4	3
β-strand	164-168	5	10
β-strand	175-176	2	11
β-strand	186-200	15	3
β-strand	203-216	14	3
α-helix	218-221	4
α-helix	222-226	5
α-helix	227-236	10
α-helix	237-241	5
α-helix	247-271	25
α-helix	280-307	28
α-helix	460-487	28

Chain H: 1 helix, 15 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	12
β-strand	5-6	2	13
β-strand	12	1	14
β-strand	18-23	6	13
β-strand	34-39	6	15
β-strand	46-52	7	15
β-strand	56-59	4	15
β-strand	64	1	13
β-strand	67-72	6	13
β-strand	77-82	6	13
α-helix	84-86	3
β-strand	89-95	7	15
β-strand	100A-103	4	15
β-strand	104	1	12
β-strand	107-108	2	15
β-strand	111	1	14

Chain J: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	16
α-helix	7-9	3
β-strand	10-12	3	17
β-strand	18-24	7	16
α-helix	29-31	3
β-strand	34-39	6	18
β-strand	46-51	6	18
β-strand	57-59	3	18
β-strand	64	1	16
β-strand	67-72	6	16
β-strand	77-82	6	16
α-helix	84-86	3
β-strand	89-95	7	18
β-strand	100A-103	4	18
β-strand	107-108	2	18
β-strand	109-111	3	17

Chain K: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-5	2	19
β-strand	10-12	3	20
β-strand	19-25	7	19
β-strand	33-38	6	20
β-strand	45-49	5	20
β-strand	53-54	2	20
α-helix	55	1
β-strand	62-66	5	19
β-strand	70-75	6	19
α-helix	80-82	3
β-strand	85-90	6	20
β-strand	96-97	2	20
β-strand	101-104	4	20

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit alpha-1	A, C	protein	455	Mus musculus	P62812 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-2	B, E	protein	512	Mus musculus	P63137 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	D	protein	474	Mus musculus	P22723 (AlphaFold model)
Heavy Chain of 8E3 Fab	H, J	protein	223	Mus musculus
Light Chain of 8E3-Fab	K, L	protein	213	Mus musculus

Sequence of entity 1 (A, C), FASTA

>8FOI_1 Gamma-aminobutyric acid receptor subunit alpha-1 (chains A, C)
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ

Sequence of entity 2 (B, E), FASTA

>8FOI_2 Gamma-aminobutyric acid receptor subunit beta-2 (chains B, E)
MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPV
AVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDT
YFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIES
YGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKR
NIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIP
YVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAANANNEKMRLDVNKM
FYKDIKQNGTQYRSLWDPTGDLSPTRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEA
VMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPD
LTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN

Sequence of entity 3 (D), FASTA

>8FOI_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains D)
MSSPNTWSIGSSVYSPVFSQKMTLWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPKV
PEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTW
YDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYT
LRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFS
FVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAV
PARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVS
NRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKD
CASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL

Sequence of entity 4 (H, J), FASTA

>8FOI_4 Heavy Chain of 8E3 Fab (chains H, J)
EIQLQQSGPELVKPGTSVKVSCKASGYSFTDYNMYWVKQSHGKSLEWIGYIDPYNADTTY
NREFKGKATLTVDKSSSTAFMHLNSLTSEDSAVYYCARKRNNFYFDYWGQGTPLTVSSAK
TTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY
TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKSAALEVLFQ

Sequence of entity 5 (K, L), FASTA

>8FOI_5 Light Chain of 8E3-Fab (chains K, L)
YIVMTQSPKSMSMSLGERVTLSCRASEYVGSYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFAGSGSATDFTLTITSVQAEDLADYHCGQTYNYPTFGGGTKLEIKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Ligands and cofactors

ID	Name	Formula	Copies
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	2
D12	Dodecane	C12 H26	17
OCT	N-octane	C8 H18	17
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	5
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	2
Y4B	allopregnanolone	C21 H34 O2	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Cryo-EM structures reveal native GABA A receptor assemblies and pharmacology. Sun, C., Zhu, H., Clark, S. et al. Nature (2023) 622:195-201. DOI 10.1038/s41586-023-06556-w · PubMed

Other PDB entries of the same protein (UniProt P62812 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8G4X 2.56 Å, Native GABA-A receptor from the mouse brain, meta-alpha1-alpha3-beta2-gamma2 subtype, in…
8G5F 2.64 Å, Native GABA-A receptor from the mouse brain, ortho-alpha1-alpha3-beta2-gamma2 subtype,…
8G4N 2.67 Å, Native GABA-A receptor from the mouse brain, alpha1-beta2-gamma2 subtype, in complex…
5OSA 2.75 Å, GLIC-GABAAR alpha1 chimera crystallized at pH4.6
8G5H 2.89 Å, Native GABA-A receptor from the mouse brain, ortho-alpha1-alpha3-beta2-gamma2 subtype,…
8G5G 2.94 Å, Native GABA-A receptor from the mouse brain, meta-alpha1-alpha3-beta2-gamma2 subtype, in…
8G4O 3.06 Å, Native GABA-A receptor from the mouse brain, alpha1-beta2-gamma2 subtype, in complex…
5OSC 3.1 Å, GLIC-GABAAR alpha1 chimera crystallized in complex with pregnenolone sulfate at pH 4.5
5OSB 3.8 Å, GLIC-GABAAR alpha1 chimera crystallized in complex with THDOC at pH4.5

Browse structure collections

About this viewer

MolViewer shows 8FOI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.