8FSO: Integrin beta-6 tail

Crystal structure of integrin beta-6 tail bound to the FERM-folded talin head domain. Determined by X-ray diffraction at 2.33 Å resolution. Released 16 Oct 2024.

Method: X-ray diffraction
Resolution: 2.33 Å
Organism: Mus musculus
Chains: 1
Atoms: 3,101
Mol. weight: 47.35 kDa
Released: 16 Oct 2024

Explore 8FSO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FSO contains 19 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	1
β-strand	13-19	7	1
β-strand	24	1	2
α-helix	25-33	9
α-helix	37-40	4
α-helix	44-46	3
β-strand	47-51	5	1
α-helix	56-58	3
β-strand	60-61	2	1
α-helix	62-63	2
β-strand	67	1	2
α-helix	68-71	4
β-strand	78-83	6	1
β-strand	85-91	7	3
β-strand	97-103	7	3
β-strand	107	1	4
α-helix	108-117	10
α-helix	124-126	3
β-strand	127-131	5	3
β-strand	173	1	3
α-helix	174-175	2
β-strand	179	1	4
α-helix	181-183	3
β-strand	190-195	6	3
α-helix	209-224	16
α-helix	232-247	16
α-helix	262-264	3
α-helix	268-270	3
α-helix	276-284	9
α-helix	291-303	13
β-strand	311-318	8	5
β-strand	325-332	8	5
β-strand	336-340	5	5
β-strand	347-352	6	5
α-helix	353-355	3
β-strand	358-361	4	5
β-strand	365-369	5	5
α-helix	371-373	3
β-strand	378-381	4	5
α-helix	385-405	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin beta-6,Talin-1	A	protein	411	Mus musculus	P26039 (AlphaFold model), Q9Z0T9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8FSO_1 Integrin beta-6,Talin-1 (chains A)
MTGTNPLYRGSMVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGL
FLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVT
DMLMTICARIGITNHDEYSLVRELMEEKKDELNWLDHGRTLREQGVEEHETLLLRRKFFY
SDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGF
LDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKM
KGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYS
VQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKST

Primary citation

Crystal structure of talin head domain in complex with beta-6 integrin reveals species-specific interactions. Wu, J., Gao, T. To be published.

Other PDB entries of the same protein (UniProt P26039 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SR0 1.49 Å, Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with…
4W8P 1.5 Å, Crystal structure of RIAM TBS1 in complex with talin R7R8 domains
9DZ5 1.74 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
7V1A 1.84 Å, Stapled TBS peptide from RIAM bound to talin R7R8 domains
3DYJ 1.85 Å, Crystal Structure of the R11R12 Domains of Talin
8FSE 1.9 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain
3IVF 1.94 Å, Crystal structure of the talin head FERM domain
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
5IC0 1.97 Å, Structural analysis of a talin triple domain module
8FTB 1.97 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
2X0C 2.0 Å, Crystal Structure of the R7R8 domains of Talin
4F7G 2.05 Å, Crystal structure of talin autoinhibition complex

Browse structure collections

About this viewer

MolViewer shows 8FSO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.