8H94: Mouse SCMC

Structure of mouse SCMC bound with KH domain of FILIA. Determined by electron microscopy at 2.9 Å resolution. Released 10 Jan 2024.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Mus musculus
Chains: 3
Atoms: 11,098
Mol. weight: 203.49 kDa
Released: 10 Jan 2024

Explore 8H94 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8H94 contains 52 α-helices and 68 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 43 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	98-108	11
α-helix	120-128	9
β-strand	140-145	6	1
α-helix	152-164	13
β-strand	174-178	5	1
α-helix	179-181	3
β-strand	187-188	2	2
α-helix	190-197	8
α-helix	202-210	9
α-helix	211-213	3
β-strand	216-220	5	1
α-helix	224-226	3
β-strand	244-245	2	2
α-helix	246-254	9
β-strand	263-267	5	1
β-strand	284-289	6	1
α-helix	293-301	9
α-helix	310-319	10
α-helix	321-326	6
α-helix	330-345	16
α-helix	357-372	16
α-helix	381-400	20
β-strand	406	1	3
α-helix	407-412	6
α-helix	417-424	8
β-strand	430-432	3	3
β-strand	439-441	3	3
α-helix	445-458	14
α-helix	464-467	4
α-helix	489-497	9
α-helix	501-511	11
α-helix	519-531	13
α-helix	539-551	13
α-helix	555-561	7
β-strand	568-571	4	4
α-helix	575-585	11
β-strand	593-597	5	4
α-helix	624-638	15
β-strand	644-646	3	4
β-strand	651	1	5
α-helix	654-664	11
β-strand	673-675	3	4
β-strand	680	1	5
α-helix	685-692	8
β-strand	701-702	2	4
α-helix	710-720	11
β-strand	729-731	3	4
α-helix	739-750	12
β-strand	757-759	3	4
α-helix	767-778	12
β-strand	786-788	3	4
α-helix	796-806	11
β-strand	814-816	3	4
α-helix	824-835	12
β-strand	843-845	3	4
α-helix	854-864	11
β-strand	866	1	6
β-strand	871-873	3	4
α-helix	881-892	12
β-strand	896	1	6
β-strand	900-902	3	4
α-helix	910-912	3
α-helix	913-922	10
β-strand	928-930	3	4
α-helix	939-948	10
β-strand	957-959	3	4
α-helix	970-978	9
β-strand	985-987	3	4
α-helix	995-1005	11
β-strand	1014-1016	3	4
α-helix	1019-1021	3
α-helix	1024-1036	13
β-strand	1041-1043	3	4
α-helix	1046-1048	3

Chain B: 5 helices, 33 β-strands

Element	Residues	Length	Sheet
α-helix	149-151	3
α-helix	158-173	16
α-helix	251-253	3
β-strand	255	1	7
β-strand	259	1	7
α-helix	264-266	3
α-helix	270-272	3
β-strand	283-291	9	8
β-strand	298-300	3	9
β-strand	307-311	5	9
β-strand	316-320	5	9
β-strand	327-328	2	8
β-strand	333-335	3	9
β-strand	346-351	6	10
β-strand	357-362	6	10
β-strand	367	1	11
β-strand	369-372	4	10
β-strand	379-382	4	10
β-strand	385	1	11
β-strand	394-396	3	12
β-strand	401-405	5	12
β-strand	410-415	6	12
β-strand	420-426	7	12
β-strand	434-437	4	13
β-strand	441-445	5	13
β-strand	450-455	6	13
β-strand	461-466	6	13
β-strand	471-476	6	14
β-strand	482-487	6	14
β-strand	492-496	5	14
β-strand	504-505	2	14
β-strand	513-518	6	15
β-strand	524-529	6	15
β-strand	533-538	6	15
β-strand	544-549	6	15
β-strand	556-559	4	8
β-strand	565-569	5	8
β-strand	573-580	8	8

Chain C: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	28-32	5	1
α-helix	38-40	3
β-strand	45-50	6	16
α-helix	51-58	8
α-helix	63-72	10
β-strand	75-79	5	16
β-strand	86-92	7	16
α-helix	95-113	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NACHT, LRR and PYD domains-containing protein 5	A	protein	1059	Mus musculus	Q9R1M5 (AlphaFold model)
Transducin-like enhancer protein 6	B	protein	581	Mus musculus	Q9WVB3 (AlphaFold model)
Oocyte-expressed protein homolog	C	protein	164	Mus musculus	Q9CWE6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8H94_1 NACHT, LRR and PYD domains-containing protein 5 (chains A)
MGPPEKDSKAILKARGLEEEQKSESTMSPSENVSRAILKDSGSEEVEQASERKMTSPEND
SKSIQKDQGPEQEQTSETLQSKEEDEVTEADKDNGGDLQDYKAHVIAKFDTSVDLHYDSP
EMKLLSDAFKPYQKTFQPHTIILHGRPGVGKSALARSIVLGWAQGKLFQKMSFVIFFSVR
EIKWTEKSSLAQLIAKECPDSWDLVTKIMSQPERLLFVIDGLDDMDSVLQHDDMTLSRDW
KDEQPIYILMYSLLRKALLPQSFLIITTRNTGLEKLKSMVVSPLYILVEGLSASRRSQLV
LENISNESDRIQVFHSLIENHQLFDQCQAPSVCSLVCEALQLQKKLGKRCTLPCQTLTGL
YATLVFHQLTLKRPSQSALSQEEQITLVGLCMMAAEGVWTMRSVFYDDDLKNYSLKESEI
LALFHMNILLQVGHNSEQCYVFSHLSLQDFFAALYYVLEGLEEWNQHFCFIENQRSIMEV
KRTDDTRLLGMKRFLFGLMNKDILKTLEVLFEYPVIPTVEQKLQHWVSLIAQQVNGTSPM
DTLDAFYCLFESQDEEFVGGALKRFQEVWLLINQKMDLKVSSYCLKHCQNLKAIRVDIRD
LLSVDNTLELCPVVTVQETQCKPLLMEWWGNFCSVLGSLRNLKELDLGDSILSQRAMKIL
CLELRNQSCRIQKLTFKSAEVVSGLKHLWKLLFSNQNLKYLNLGNTPMKDDDMKLACEAL
KHPKCSVETLRLDSCELTIIGYEMISTLLISTTRLKCLSLAKNRVGVKSMISLGNALSSS
MCLLQKLILDNCGLTPASCHLLVSALFSNQNLTHLCLSNNSLGTEGVQQLCQFLRNPECA
LQRLILNHCNIVDDAYGFLAMRLANNTKLTHLSLTMNPVGDGAMKLLCEALKEPTCYLQE
LELVDCQLTQNCCEDLACMITTTKHLKSLDLGNNALGDKGVITLCEGLKQSSSSLRRLGL
GACKLTSNCCEALSLAISCNPHLNSLNLVKNDFSTSGMLKLCSAFQCPVSNLGIIGLWKQ
EYYARVRRQLEEVEFVKPHVVIDGDWYASDEDDRNWWKN

Sequence of entity 2 (B), FASTA

>8H94_2 Transducin-like enhancer protein 6 (chains B)
MTSHRQSSDTFGGILPSTLSSRYLSIVNQLPEEFSSVVSEMMVHLENIFSLAENFFQAIE
RFSRTPDLLERNKMSIGVGAEGDSWPCHVSHEAPMGSAQTTENSAKEEDKQVPESAALQH
PKFKSTPGPQLPTRRRFLSESDELQDPQPVWDAEPQFCQGFLIQGLWELFMDSRQKNQQE
HGGEDSSQESKDSGLCDFKPEPQPRHRNSLSDSADPFLIKSPSALLDYYQEDVSRPQPET
QESSGRADKFLKPLSWGSEVLESSCNQPSTALWQLERFTVPQALQKVRVLKHQELLLVVA
VSSFTRHVFTCSQSGIKVWNLVNQVAEDRDPESHLKCSVQDNKVYLRTCLLSSNSRTLFA
GGYNLPGVIVWDLAAPSLYEKCQLPCEGLSCQALANTKENMALAGFTDGTVRIWDLRTQE
IVRNLKGPTNSARNLVVKDDNIWTGGLDACLRCWDLRMAKVSLEHLFQSQIMSLAHSPTE
DWLLLGLANGQHCLFNSRKRDQVLTVDTKDNTILGLKFSPNGKWWASVGMGNFITVHSMP
TGAKLFQVPEVGPVRCFDMTENGRLIITGSRDCASVYHIKY

Sequence of entity 3 (C), FASTA

>8H94_3 Oocyte-expressed protein homolog (chains C)
MASHTADADAKPDSDSQKLLNVLPVSLRLRTRPWWFPIQEVSNPLVLYMEAWVAERVIGT
DQAEISEIEWMCQALLTVDSVNSGNLAEITIFGQPSAQTRMKNILLNMAAWHKENELQRA
VKVKEVEEFLKIRASSILSKLSKKGLKLAGFPLPLEGRETQMES

Primary citation

Structural basis of the subcortical maternal complex and its implications in reproductive disorders. Chi, P., Ou, G., Qin, D. et al. Nat Struct Mol Biol (2024) 31:115-124. DOI 10.1038/s41594-023-01153-x · PubMed

Other PDB entries of the same protein (UniProt Q9R1M5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8H96 2.78 Å, Structure of mouse SCMC core complex
8XI3 3.0 Å, Structure of mouse SCMC-14-3-3gama complex
9L4J 3.0 Å, Structure of mouse SCMCcore complex contain ZBED3
8H93 3.01 Å, Structure of dimeric mouse SCMC core complex
8H95 3.38 Å, Structure of mouse SCMC bound with full-length FILIA
24MC 3.4 Å, Structure of oocyte cytoplasmic lattices
12DL 3.5 Å, Native structure of the cytoplasmic lattice (CPL) asymmetric unit from mouse MII eggs
9XRL 3.74 Å, Structure of mouse cytoplasmic lattice (CPL) repeating unit
9SFP 4.2 Å, Native cytoplasmic lattices from mouse oocytes
9W2M 4.2 Å, Cryo-EM structure of the Cytoplasmic lattice(CPL) from mouse oocyte
9T63 4.7 Å, Asymmetric unit of a cytoplasmic lattice filament repeat unit
9T66 5.3 Å, Complex linking two repeat units of a cytoplasmic lattice filament

Browse structure collections

About this viewer

MolViewer shows 8H94 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.