8WGD: MGlu2-4 inactive heterodimer

mGlu2-4 inactive heterodimer. Determined by electron microscopy at 4.45 Å resolution. Released 27 Nov 2024.

Method: Electron microscopy
Resolution: 4.45 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,076
Mol. weight: 192.85 kDa
Ligands: WA6, WAG
Released: 27 Nov 2024

Explore 8WGD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8WGD contains 70 α-helices and 65 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 32 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	45	1	10
β-strand	51-55	5	10
β-strand	58-62	5	11
β-strand	65-70	6	11
α-helix	72-76	5
α-helix	77-89	13
β-strand	99	1	12
β-strand	103-107	5	10
α-helix	112-125	14
β-strand	152-155	4	10
α-helix	159-169	11
β-strand	176-178	3	10
α-helix	184-187	4
β-strand	195-197	3	10
α-helix	202-215	14
β-strand	221-226	6	13
α-helix	229-245	17
β-strand	250-256	7	13
α-helix	264-272	9
β-strand	280-284	5	13
α-helix	287-299	13
β-strand	303	1	14
β-strand	306	1	14
β-strand	307-310	4	13
α-helix	319-321	3
α-helix	325-328	4
β-strand	332-336	5	13
α-helix	342-345	4
α-helix	358-369	12
β-strand	394	1	15
β-strand	398	1	15
α-helix	405-427	23
β-strand	433	1	12
α-helix	443-451	9
β-strand	454-456	3	16
β-strand	462-464	3	16
β-strand	475-483	9	13
β-strand	486-495	10	13
β-strand	499-501	3	13
α-helix	503-505	3
β-strand	508	1	17
β-strand	512	1	17
α-helix	522-525	4
β-strand	528-533	6	18
β-strand	536-544	9	18
β-strand	549-553	5	19
β-strand	556-559	4	19
α-helix	560-561	2
β-strand	564-566	3	20
β-strand	573-575	3	20
β-strand	578-579	2	21
α-helix	586-611	26
α-helix	616-619	4
α-helix	624-644	21
α-helix	649-683	35
α-helix	696-720	25
β-strand	725-727	3	22
α-helix	729-732	4
α-helix	737-739	3
β-strand	742-743	2	21
β-strand	744-746	3	22
α-helix	751	1
α-helix	752-757	6
α-helix	758-775	18
α-helix	785-799	15
α-helix	802-807	6
α-helix	814-837	24
α-helix	839-846	8

Chain C: 38 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	26-28	3	1
β-strand	32-37	6	1
β-strand	41	1	2
β-strand	45	1	3
β-strand	48	1	3
β-strand	53	1	2
α-helix	59-74	16
β-strand	84-88	5	1
β-strand	92	1	2
α-helix	95-108	14
β-strand	139-141	3	1
α-helix	145-155	11
α-helix	156-158	3
β-strand	162-164	3	1
α-helix	175-178	4
β-strand	181-183	3	1
α-helix	186-187	2
α-helix	189-201	13
β-strand	206-212	7	4
α-helix	215-230	16
β-strand	234-241	8	4
α-helix	243-245	3
α-helix	246-258	13
β-strand	265-269	5	4
α-helix	272-284	13
β-strand	290-293	4	4
α-helix	295-297	3
α-helix	301-303	3
α-helix	305-310	6
β-strand	315-319	5	4
α-helix	325-332	8
α-helix	345-352	8
α-helix	367-369	3
α-helix	376-399	24
α-helix	408-410	3
α-helix	415-417	3
α-helix	418-422	5
β-strand	453-459	7	4
β-strand	467-473	7	4
β-strand	479-480	2	4
α-helix	482-484	3
β-strand	508-512	5	5
β-strand	521-524	4	5
α-helix	525-526	2
β-strand	529-533	5	6
β-strand	536-539	4	6
β-strand	544-546	3	7
β-strand	553-555	3	7
α-helix	556-557	2
β-strand	558	1	8
α-helix	565-567	3
α-helix	571-577	7
α-helix	578-581	4
α-helix	585-592	8
α-helix	600-603	4
α-helix	604-606	3
α-helix	608-625	18
α-helix	629-637	9
α-helix	639-660	22
α-helix	676-700	25
β-strand	716	1	8
α-helix	727-746	20
β-strand	753-754	2	9
β-strand	756-757	2	9
α-helix	759-780	22
α-helix	789-809	21
α-helix	811-817	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Metabotropic glutamate receptor 2	C	protein	854	Homo sapiens	Q14416 (AlphaFold model)
Metabotropic glutamate receptor 4	B	protein	880	Homo sapiens	Q14833 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>8WGD_1 Metabotropic glutamate receptor 2 (chains C)
EGPAKKVLTLEGDLVLGGLFPVHQKGGPAEDCGPVNEHRGIQRLEAMLFALDRINRDPHL
LPGVRLGAHILDSCSKDTHALEQALDFVRASLSRGADGSRHICPDGSYATHGDAPTAITG
VIGGSYSDVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFFQAKAMAEI
LRFFNWTYVSTVASEGDYGETGIEAFELEARARNICVATSEKVGRAMSRAAFEGVVRALL
QKPSARVAVLFTRSEDARELLAASQRLNASFTWVASDGWGALESVVAGSEGAAEGAITIE
LASYPISDFASYFQSLDPWNNSRNPWFREFWEQRFRCSFRQRDCAAHSLRAVPFEQESKI
MFVVNAVYAMAHALHNMHRALCPNTTRLCDAMRPVNGRRLYKDFVLNVKFDAPFRPADTH
NEVRFDRFGDGIGRYNIFTYLRAGSGRYRYQKVGYWAEGLTLDTSLIPWASPSAGPLPAS
RCSEPCLQNEVKSVQPGEVCCWLCIPCQPYEYRLDEFTCADCGLGYWPNASLTGCFELPQ
EYIRWGDAWAVGPVTIACLGALATLFVLGVFVRHNATPVVKASGRELCYILLGGVFLCYC
MTFIFIAKPSTAVCTLRRLGLGTAFSVCYSALLTKTNRIARIFGGAREGAQRPRFISPAS
QVAICLALISGQLLIVVAWLVVEAPGTGKETAPERREVVTLRCNHRDASMLGSLAYNVLL
IALCTLYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCVSV
SLSGSVVLGCLFAPKLHIILFQPQKNVVSHRAPTSRFGSAAARASSSLGQGSGSQFVPTV
CNGREVVDSTTSSL

Sequence of entity 2 (B), FASTA

>8WGD_2 Metabotropic glutamate receptor 4 (chains B)
KPKGHPHMNSIRIDGDITLGGLFPVHGRGSEGKPCGELKKEKGIHRLEAMLFALDRINND
PDLLPNITLGARILDTCSRDTHALEQSLTFVQALIEKDGTEVRCGSGGPPIITKPERVVG
VIGASGSSVSIMVANILRLFKIPQISYASTAPDLSDNSRYDFFSRVVPSDTYQAQAMVDI
VRALKWNYVSTVASEGSYGESGVEAFIQKSREDGGVCIAQSVKIPREPKAGEFDKIIRRL
LETSNARAVIIFANEDDIRRVLEAARRANQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAV
TILPKRMSVRGFDRYFSSRTLDNNRRNIWFAEFWEDNFHCKLSRHALKKGSHVKKCTNRE
RIGQDSAYEQEGKVQFVIDAVYAMGHALHAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRN
VNFSGIAGNPVTFNENGDAPGRYDIYQYQLRNDSAEYKVIGSWTDHLHLRIERMHWPGSG
QQLPRSICSLPCQPGERKKTVKGMPCCWHCEPCTGYQYQVDRYTCKTCPYDMRPTENRTG
CRPIPIIKLEWGSPWAVLPLFLAVVGIAATLFVVITFVRYNDTPIVKASGRELSYVLLAG
IFLCYATTFLMIAEPDLGTCSLRRIFLGLGMSISYAALLTKTNRIYRIFEQGKRSVSAPR
FISPASQLAITFSLISLQLLGICVWFVVDPSHSVVDFQDQRTLDPRFARGVLKCDISDLS
LICLLGYSMLLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSA
DKLYIQTTTLTVSVSLSASVSLGMLYMPKVYIILFHPEQNVPKRKRSLKAVVTAATMSNK
FTQKGNFRPNGEAKSELCENLEAPALATKQTYVTYTNHAI

Ligands and cofactors

ID	Name	Formula	Copies
WA6	(2S)-2-azanyl-2-cyclopropyl-2-(4-phosphonophenyl)ethanoic acid	C11 H14 N O5 P	1
WAG	(1S,2R)-2-[(2S)-2-azanyl-1-oxidanyl-1-oxidanylidene-3-(9H-xanthen-9-yl)propan-2…	C20 H19 N O5	1

Primary citation

Structural basis of orientated asymmetry in a mGlu heterodimer. Huang, W., Jin, N., Guo, J. et al. Nat Commun (2024) 15:10345-10345. DOI 10.1038/s41467-024-54744-7 · PubMed

Other PDB entries of the same protein (UniProt Q14416 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4XAQ 2.21 Å, mGluR2 ECD and mGluR3 ECD with ligands
4XAS 2.35 Å, mGluR2 ECD ligand complex
7EPE 2.5 Å, Crystal structure of mGlu2 bound to NAM563
5CNJ 2.65 Å, mGlur2 with glutamate analog
5CNI 2.69 Å, mGlu2 with Glutamate
7EPF 2.7 Å, Crystal structure of mGlu2 bound to NAM597
5KZN 2.8 Å, Metabotropic Glutamate Receptor
5KZQ 2.8 Å, Metabotropic Glutamate Receptor in complex with antagonist…
8JCU 2.8 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495 (dimerization mode I)
8JD2 2.8 Å, Cryo-EM structure of G protein-free mGlu2-mGlu3 heterodimer in Acc state
8JCY 2.9 Å, Cryo-EM structure of mGlu2-mGlu3 heterodimer in presence of LY341495, NAM563, and…
8JD4 2.9 Å, Cryo-EM structure of G protein-free mGlu2-mGlu4 heterodimer in Acc state

Browse structure collections

About this viewer

MolViewer shows 8WGD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.