9BTG: Human SCNN1B-SCNN1B-SCNN1G ENaC trimer

Human SCNN1B-SCNN1B-SCNN1G ENaC trimer. Determined by electron microscopy at 3.12 Å resolution. Released 27 Nov 2024.

Method: Electron microscopy
Resolution: 3.12 Å
Organism: Homo sapiens
Chains: 3
Atoms: 9,838
Mol. weight: 222.2 kDa
Ligands: NAG
Released: 27 Nov 2024

Explore 9BTG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9BTG contains 60 α-helices and 70 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	80-86	7	1
β-strand	90-91	2	2
α-helix	92-93	2
β-strand	94-99	6	3
α-helix	105-127	23
α-helix	142-145	4
β-strand	150-154	5	4
β-strand	162-165	4	4
α-helix	182-184	3
β-strand	189-197	9	4
β-strand	202-208	7	4
α-helix	211-227	17
α-helix	232-235	4
α-helix	236-238	3
α-helix	242-245	4
β-strand	246-251	6	1
β-strand	254-256	3	1
α-helix	258-260	3
β-strand	261-266	6	3
β-strand	270-275	6	3
α-helix	282-284	3
β-strand	285-286	2	2
α-helix	291-293	3
β-strand	295-300	6	1
α-helix	303-305	3
β-strand	314	1	5
β-strand	315-321	7	3
α-helix	329-332	4
β-strand	334-337	4	3
β-strand	340-352	13	1
β-strand	362	1	6
α-helix	365-367	3
α-helix	379-381	3
α-helix	383-398	16
β-strand	402	1	7
β-strand	414	1	7
α-helix	423-432	10
α-helix	434-443	10
β-strand	447	1	6
β-strand	449-461	13	1
α-helix	468-477	10
α-helix	489-491	3
β-strand	492-510	19	1

Chain B: 21 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	79-86	8	5
β-strand	90-91	2	8
α-helix	92-93	2
β-strand	94-99	6	9
α-helix	105-127	23
α-helix	142-145	4
β-strand	150-154	5	10
β-strand	162-165	4	10
α-helix	182-184	3
β-strand	189-197	9	10
β-strand	202-208	7	10
α-helix	211-227	17
α-helix	232-235	4
α-helix	236-238	3
α-helix	242-245	4
β-strand	246-251	6	5
β-strand	254-256	3	5
α-helix	258-260	3
β-strand	261-266	6	9
β-strand	270-275	6	9
α-helix	282-284	3
β-strand	285-286	2	8
α-helix	291-293	3
β-strand	295-300	6	5
α-helix	303-305	3
β-strand	314	1	11
β-strand	316-321	6	9
α-helix	329-332	4
β-strand	334-336	3	9
β-strand	340-352	13	5
β-strand	362	1	12
α-helix	375-377	3
α-helix	379-381	3
α-helix	383-398	16
β-strand	402	1	13
β-strand	414	1	13
α-helix	423-432	10
α-helix	434-441	8
α-helix	444-446	3
β-strand	447	1	12
β-strand	449-461	13	5
α-helix	469-475	7
α-helix	489-491	3
β-strand	492-511	20	5

Chain C: 19 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	81-85	5	11
β-strand	88-89	2	11
β-strand	92-93	2	14
α-helix	94-95	2
β-strand	96-101	6	15
α-helix	107-110	4
α-helix	115-129	15
β-strand	161-163	3	16
β-strand	201-207	7	16
β-strand	214-219	6	16
α-helix	222-238	17
α-helix	243-249	7
α-helix	253-256	4
β-strand	257-262	6	11
β-strand	265-267	3	11
α-helix	269-271	3
β-strand	272-277	6	15
β-strand	281-286	6	15
α-helix	293-295	3
β-strand	296-297	2	14
α-helix	302-304	3
β-strand	306-311	6	11
α-helix	314-316	3
β-strand	325	1	1
β-strand	327-332	6	15
β-strand	345-347	3	15
β-strand	351-363	13	11
β-strand	373	1	17
α-helix	376-378	3
α-helix	382-383	2
α-helix	391-406	16
β-strand	410	1	18
α-helix	415-417	3
β-strand	422	1	18
α-helix	431-443	13
α-helix	449-452	4
β-strand	456	1	17
β-strand	458-465	8	11
β-strand	468-470	3	11
α-helix	477-488	12
α-helix	495-497	3
α-helix	498-500	3
β-strand	501-520	20	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amiloride-sensitive sodium channel subunit beta	A, B	protein	640	Homo sapiens	P51168 (AlphaFold model)
Amiloride-sensitive sodium channel subunit gamma	C	protein	649	Homo sapiens	P51170 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9BTG_1 Amiloride-sensitive sodium channel subunit beta (chains A, B)
MHVKKYLLKGLHRLQKGPGYTYKELLVWYADNTNTHGPKRIICEGPKKKAMWFLLTLLFA
ALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELME
AVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSAS
EKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSY
PGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILD
IGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSP
CTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDF
PDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERD
QSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEF
GEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPN
TGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI

Sequence of entity 2 (C), FASTA

>9BTG_2 Amiloride-sensitive sodium channel subunit gamma (chains C)
MAPGEKIKAKIKKNLPVTGPQAPTIKELMRWYALNTNTHGARRIVVSRGRLRRLLWIGFT
LTAVALILWQCALLVFSFYTVSVSIKVHFRKLDFPAVTICNINPYKYSTVRHLLADLEQE
TREALKSLYGFPESRKRAEAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKR
KVGGSIIHKASNVMHIESKQVVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHYMNIMAQ
VPLEKKINMSYSAEELLVTCFFDGVSCDARNFTLFHHPMHGNCYTFNNRENETILSTSMG
GSEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLT
ESFKLSEPYSQCTEDGSDVPIRNIYNAAYSLQICLHSCFQTKMVEKCGCAQYSQPLPPAA
NYCNYQQHPNWMYCYYQLHRAFVQEELGCQSVCKEACSFKEWTLTTSLAQWPSVVSEKWL
LPVLTWDQGRQVNKKLNKTDLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQLGLWMS
CSVVCVIEIIEVFFIDFFSIIARRQWQKAKEWWAWKQAPPCPEAPRSPQGQDNPALDIDD
DLPTFNSALHLPPALGTQVPGTPPPKYNTLRLERAFSNQLTDTQMLDEL

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	6

Primary citation

Structural insights into subunit-dependent functional regulation in epithelial sodium channels. Houser, A., Baconguis, I. Structure (2025) 33:349-362.e4. DOI 10.1016/j.str.2024.11.013 · PubMed

Other PDB entries of the same protein (UniProt P51168 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WTH 3.06 Å, Full-length human ENaC ECD
9BLR 3.38 Å, Human SCNN1D-SCNN1B-SCNN1G ENaC trimer
9BTU 3.68 Å, Human SCNN1B-SCNN1G ENaC dimers
6BQN 3.9 Å, Cryo-EM structure of ENaC

Browse structure collections

About this viewer

MolViewer shows 9BTG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.