9BTU: Human SCNN1B-SCNN1G ENaC dimers

Human SCNN1B-SCNN1G ENaC dimers. Determined by electron microscopy at 3.68 Å resolution. Released 27 Nov 2024.

Method: Electron microscopy
Resolution: 3.68 Å
Organisms: Homo sapiens, Mus musculus
Chains: 4
Atoms: 7,861
Mol. weight: 166.49 kDa
Ligands: NAG
Released: 27 Nov 2024

Explore 9BTU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9BTU contains 46 α-helices and 72 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 22 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	79-83	5	1
β-strand	86	1	2
β-strand	90-91	2	3
α-helix	92-93	2
β-strand	94-98	5	4
α-helix	105-127	23
α-helix	129-131	3
α-helix	134-137	4
α-helix	142-145	4
β-strand	150-154	5	5
β-strand	162-165	4	5
α-helix	182-184	3
β-strand	189-197	9	5
β-strand	202-208	7	5
α-helix	211-227	17
α-helix	232-235	4
α-helix	236-238	3
α-helix	242-245	4
β-strand	246-251	6	2
β-strand	254-255	2	2
α-helix	258-260	3
β-strand	262-266	5	4
β-strand	270-275	6	4
α-helix	282-284	3
β-strand	285-286	2	3
α-helix	291-293	3
β-strand	295-300	6	2
α-helix	303-305	3
β-strand	314	1	6
β-strand	316-321	6	4
α-helix	329-332	4
β-strand	334-336	3	4
β-strand	340	1	7
β-strand	341-351	11	2
β-strand	361-362	2	8
α-helix	373-377	5
α-helix	379-381	3
α-helix	383-399	17
β-strand	402	1	9
β-strand	414	1	9
α-helix	423-432	10
α-helix	434-443	10
α-helix	445	1
β-strand	446-447	2	8
β-strand	450-458	9	2
β-strand	461	1	7
α-helix	468-479	12
β-strand	492-506	15	2
β-strand	507-511	5	1

Chain C: 17 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	81-86	6	6
β-strand	92-93	2	13
β-strand	96-101	6	14
α-helix	107-125	19
α-helix	154-157	4
β-strand	160-164	5	15
β-strand	172-173	2	15
β-strand	186	1	16
β-strand	197	1	16
β-strand	200-207	8	15
β-strand	214-219	6	15
α-helix	222-238	17
α-helix	243-249	7
α-helix	253-256	4
β-strand	257-262	6	6
β-strand	265-266	2	6
α-helix	269-271	3
β-strand	272-277	6	14
β-strand	281-286	6	14
α-helix	293-295	3
β-strand	296-297	2	13
α-helix	302-304	3
β-strand	306-311	6	6
α-helix	314-316	3
β-strand	326-332	7	14
β-strand	345-348	4	14
β-strand	351-363	13	6
β-strand	367	1	17
β-strand	370	1	17
β-strand	373	1	18
α-helix	391-407	17
β-strand	410	1	19
α-helix	415-417	3
α-helix	421	1
β-strand	422	1	19
α-helix	423	1
α-helix	431-443	13
α-helix	449-452	4
β-strand	456	1	18
β-strand	458-465	8	6
β-strand	468-470	3	6
α-helix	477-486	10
α-helix	498-500	3
β-strand	501-508	8	6
β-strand	514-520	7	6

Chain D: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	10
β-strand	10	1	11
α-helix	12-14	3
β-strand	18-25	8	10
β-strand	37	1	12
α-helix	62-67	6
β-strand	69-73	5	10
α-helix	74-76	3
β-strand	78-83	6	10
α-helix	88-90	3
β-strand	92	1	11
β-strand	95	1	12
β-strand	114	1	11

Chain E: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	5-6	2	20
α-helix	17-19	3
β-strand	22-24	3	20
β-strand	42	1	21
α-helix	48-49	2
β-strand	50	1	21
β-strand	53	1	22
β-strand	59	1	22
β-strand	70	1	20
β-strand	75-77	3	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amiloride-sensitive sodium channel subunit beta	B	protein	640	Homo sapiens	P51168 (AlphaFold model)
10D4 Fab	D	protein	116	Mus musculus
Amiloride-sensitive sodium channel subunit gamma	C	protein	649	Homo sapiens	P51170 (AlphaFold model)
10D4 Fab	E	protein	73	Mus musculus

Sequence of entity 1 (B), FASTA

>9BTU_1 Amiloride-sensitive sodium channel subunit beta (chains B)
MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFA
ALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELME
AVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSAS
EKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSY
PGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILD
IGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSP
CTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDF
PDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERD
QSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEF
GEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPN
TGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI

Sequence of entity 2 (D), FASTA

>9BTU_2 10D4 Fab (chains D)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Sequence of entity 3 (C), FASTA

>9BTU_3 Amiloride-sensitive sodium channel subunit gamma (chains C)
MAPGEKIKAKIKKNLPVTGPQAPTIKELMRWYCLNTNTHGCRRIVVSRGRLRRLLWIGFT
LTAVALILWQCALLVFSFYTVSVSIKVHFRKLDFPAVTICNINPYKYSTVRHLLADLEQE
TREALKSLYGFPESRKRREAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKR
KVGGSIIHKASNVMHIESKQVVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHYMNIMAQ
VPLEKKINMSYSAEELLVTCFFDGVSCDARNFTLFHHPMHGNCYTFNNRENETILSTSMG
GSEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLT
ESFKLSEPYSQCTEDGSDVPIRNIYNAAYSLQICLHSCFQTKMVEKCGCAQYSQPLPPAA
NYCNYQQHPNWMYCYYQLHRAFVQEELGCQSVCKEACSFKEWTLTTSLAQWPSVVSEKWL
LPVLTWDQGRQVNKKLNKTDLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQLGLWMS
CSVVCVIEIIEVFFIDFFSIIARRQWQKAKEWWAWKQAPPCPEAPRSPQGQDNPALDIDD
DLPTFNSALHLPPALGTQVPGTPPPKYNTLRLERAFSNQLTDTQMLDEL

Sequence of entity 4 (E), FASTA

>9BTU_4 10D4 Fab (chains E)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXX

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5

Primary citation

Structural insights into subunit-dependent functional regulation in epithelial sodium channels. Houser, A., Baconguis, I. Structure (2025) 33:349-362.e4. DOI 10.1016/j.str.2024.11.013 · PubMed

Other PDB entries of the same protein (UniProt P51168 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WTH 3.06 Å, Full-length human ENaC ECD
9BTG 3.12 Å, Human SCNN1B-SCNN1B-SCNN1G ENaC trimer
9BLR 3.38 Å, Human SCNN1D-SCNN1B-SCNN1G ENaC trimer
6BQN 3.9 Å, Cryo-EM structure of ENaC

Browse structure collections

About this viewer

MolViewer shows 9BTU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.