9DMK: Human muscle nAChR with one fab1b-bound
Human muscle nAChR with one fab1b-bound. Determined by electron microscopy at 2.46 Å resolution. Released 9 Apr 2025.
- Method
- Electron microscopy
- Resolution
- 2.46 Å
- Organism
- Homo sapiens
- Chains
- 7
- Atoms
- 20,262
- Mol. weight
- 336.14 kDa
- Ligands
- CLR, NAG, POV
- Released
- 9 Apr 2025
Explore 9DMK in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9DMK contains 90 α-helices and 125 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 15 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| β-strand | 27 | 1 | 1 |
| β-strand | 29-44 | 16 | 2 |
| β-strand | 49-61 | 13 | 2 |
| α-helix | 69-72 | 4 | |
| β-strand | 77-81 | 5 | 2 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 3 |
| β-strand | 95 | 1 | 2 |
| β-strand | 107-111 | 5 | 2 |
| β-strand | 115-118 | 4 | 2 |
| β-strand | 121-127 | 7 | 2 |
| β-strand | 139-148 | 10 | 3 |
| β-strand | 156-160 | 5 | 2 |
| β-strand | 166 | 1 | 2 |
| α-helix | 170-173 | 4 | |
| β-strand | 176-188 | 13 | 3 |
| β-strand | 198-209 | 12 | 3 |
| α-helix | 212-214 | 3 | |
| α-helix | 215-219 | 5 | |
| α-helix | 220-230 | 11 | |
| α-helix | 231-234 | 4 | |
| α-helix | 237-239 | 3 | |
| α-helix | 242-263 | 22 | |
| α-helix | 273-299 | 27 | |
| α-helix | 310-312 | 3 | |
| α-helix | 313-319 | 7 | |
| α-helix | 320-323 | 4 | |
| α-helix | 370-435 | 66 | |
Chain B: 15 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-12 | 10 | |
| β-strand | 29-44 | 16 | 13 |
| β-strand | 49-61 | 13 | 13 |
| α-helix | 63-65 | 3 | |
| β-strand | 77-80 | 4 | 13 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 14 |
| β-strand | 95 | 1 | 13 |
| α-helix | 106-107 | 2 | |
| β-strand | 108-111 | 4 | 13 |
| β-strand | 115-118 | 4 | 13 |
| β-strand | 121-127 | 7 | 13 |
| β-strand | 139-148 | 10 | 14 |
| β-strand | 156-160 | 5 | 13 |
| β-strand | 162 | 1 | 15 |
| β-strand | 168 | 1 | 15 |
| β-strand | 171 | 1 | 16 |
| β-strand | 173 | 1 | 13 |
| β-strand | 185-189 | 5 | 14 |
| β-strand | 191 | 1 | 16 |
| β-strand | 192-197 | 6 | 14 |
| β-strand | 207-218 | 12 | 14 |
| α-helix | 221-223 | 3 | |
| α-helix | 224-228 | 5 | |
| α-helix | 229-237 | 9 | |
| α-helix | 238-243 | 6 | |
| α-helix | 252-271 | 20 | |
| α-helix | 283-309 | 27 | |
| α-helix | 320-323 | 4 | |
| α-helix | 324-329 | 6 | |
| α-helix | 330-333 | 4 | |
| α-helix | 398-458 | 61 | |
| α-helix | 461-463 | 3 | |
Chain C: 14 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| β-strand | 29-44 | 16 | 4 |
| β-strand | 49-61 | 13 | 4 |
| α-helix | 69-72 | 4 | |
| β-strand | 77-81 | 5 | 4 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 5 |
| β-strand | 95 | 1 | 4 |
| β-strand | 101 | 1 | 5 |
| β-strand | 107-111 | 5 | 4 |
| β-strand | 115-118 | 4 | 4 |
| β-strand | 121-127 | 7 | 4 |
| β-strand | 139-148 | 10 | 5 |
| β-strand | 156-160 | 5 | 4 |
| β-strand | 166 | 1 | 4 |
| α-helix | 170-173 | 4 | |
| β-strand | 176-188 | 13 | 5 |
| β-strand | 198-209 | 12 | 5 |
| α-helix | 212-214 | 3 | |
| α-helix | 215-219 | 5 | |
| α-helix | 220-230 | 11 | |
| α-helix | 231-234 | 4 | |
| α-helix | 242-263 | 22 | |
| α-helix | 273-299 | 27 | |
| α-helix | 310-313 | 4 | |
| α-helix | 314-319 | 6 | |
| α-helix | 321-323 | 3 | |
| α-helix | 370-435 | 66 | |
Chain D: 17 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-8 | 6 | |
| α-helix | 9-14 | 6 | |
| β-strand | 31-46 | 16 | 9 |
| β-strand | 51-68 | 18 | 9 |
| α-helix | 72-74 | 3 | |
| β-strand | 79-82 | 4 | 9 |
| α-helix | 84-86 | 3 | |
| β-strand | 93-94 | 2 | 10 |
| β-strand | 97 | 1 | 9 |
| α-helix | 108-109 | 2 | |
| β-strand | 110-113 | 4 | 9 |
| β-strand | 115-120 | 6 | 9 |
| β-strand | 123-129 | 7 | 9 |
| β-strand | 141-149 | 9 | 10 |
| β-strand | 158-162 | 5 | 9 |
| β-strand | 164-166 | 3 | 11 |
| β-strand | 171-173 | 3 | 11 |
| β-strand | 176 | 1 | 12 |
| β-strand | 178 | 1 | 9 |
| α-helix | 184-187 | 4 | |
| β-strand | 190-194 | 5 | 10 |
| β-strand | 196 | 1 | 12 |
| β-strand | 197-201 | 5 | 10 |
| β-strand | 213-223 | 11 | 10 |
| α-helix | 226-228 | 3 | |
| α-helix | 229-233 | 5 | |
| α-helix | 234-241 | 8 | |
| α-helix | 242-247 | 6 | |
| α-helix | 256-275 | 20 | |
| α-helix | 287-313 | 27 | |
| α-helix | 324-328 | 5 | |
| α-helix | 329-333 | 5 | |
| α-helix | 334-337 | 4 | |
| α-helix | 340-343 | 4 | |
| α-helix | 409-472 | 64 | |
Chain E: 17 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| β-strand | 29-44 | 16 | 6 |
| β-strand | 49-66 | 18 | 6 |
| α-helix | 69-71 | 3 | |
| β-strand | 77-81 | 5 | 6 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 7 |
| β-strand | 95 | 1 | 6 |
| β-strand | 107-111 | 5 | 6 |
| β-strand | 113-118 | 6 | 6 |
| β-strand | 121-127 | 7 | 6 |
| β-strand | 139-148 | 10 | 7 |
| β-strand | 156-160 | 5 | 6 |
| β-strand | 171 | 1 | 8 |
| β-strand | 173 | 1 | 6 |
| β-strand | 180 | 1 | 6 |
| β-strand | 185-189 | 5 | 7 |
| β-strand | 191 | 1 | 8 |
| β-strand | 192-195 | 4 | 7 |
| α-helix | 196-198 | 3 | |
| β-strand | 211-220 | 10 | 7 |
| α-helix | 223-225 | 3 | |
| α-helix | 226-230 | 5 | |
| α-helix | 231-242 | 12 | |
| α-helix | 243-245 | 3 | |
| α-helix | 248-250 | 3 | |
| α-helix | 253-271 | 19 | |
| α-helix | 284-310 | 27 | |
| α-helix | 318-320 | 3 | |
| α-helix | 321-324 | 4 | |
| α-helix | 325-330 | 6 | |
| α-helix | 331-334 | 4 | |
| α-helix | 408-468 | 61 | |
| α-helix | 471-473 | 3 | |
Chain F: 5 helices, 23 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 34-37 | 4 | 17 |
| β-strand | 41-43 | 3 | 18 |
| β-strand | 49-56 | 8 | 17 |
| β-strand | 65-70 | 6 | 18 |
| β-strand | 76-83 | 8 | 18 |
| β-strand | 88-91 | 4 | 18 |
| α-helix | 93-95 | 3 | |
| β-strand | 99-104 | 6 | 17 |
| β-strand | 109-114 | 6 | 17 |
| α-helix | 119-121 | 3 | |
| β-strand | 123-129 | 7 | 18 |
| β-strand | 134 | 1 | 1 |
| β-strand | 142-143 | 2 | 18 |
| β-strand | 147-151 | 5 | 18 |
| β-strand | 157 | 1 | 19 |
| β-strand | 160-164 | 5 | 20 |
| β-strand | 175-185 | 11 | 20 |
| β-strand | 186 | 1 | 19 |
| β-strand | 190-194 | 5 | 21 |
| α-helix | 195-197 | 3 | |
| β-strand | 199 | 1 | 21 |
| β-strand | 204-205 | 2 | 20 |
| α-helix | 206-208 | 3 | |
| β-strand | 209-210 | 2 | 20 |
| β-strand | 216-225 | 10 | 20 |
| α-helix | 226-229 | 4 | |
| β-strand | 235-240 | 6 | 21 |
| β-strand | 245-250 | 6 | 21 |
Chain G: 7 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 23-26 | 4 | 22 |
| β-strand | 29-32 | 4 | 23 |
| β-strand | 38-44 | 7 | 22 |
| β-strand | 49 | 1 | 24 |
| β-strand | 55 | 1 | 24 |
| β-strand | 57-62 | 6 | 23 |
| α-helix | 67 | 1 | |
| β-strand | 68-73 | 6 | 23 |
| β-strand | 77-78 | 2 | 23 |
| α-helix | 79 | 1 | |
| β-strand | 86-90 | 5 | 22 |
| β-strand | 94-99 | 6 | 22 |
| β-strand | 109-114 | 6 | 23 |
| α-helix | 120 | 1 | |
| β-strand | 121-122 | 2 | 23 |
| β-strand | 126-130 | 5 | 23 |
| α-helix | 136-137 | 2 | |
| β-strand | 138-142 | 5 | 25 |
| α-helix | 143-145 | 3 | |
| α-helix | 148-151 | 4 | |
| β-strand | 153-163 | 11 | 25 |
| β-strand | 172-173 | 2 | 26 |
| β-strand | 178 | 1 | 26 |
| β-strand | 183-187 | 5 | 25 |
| β-strand | 197-206 | 10 | 25 |
| α-helix | 207-212 | 6 | |
| β-strand | 217-220 | 4 | 26 |
| β-strand | 229-231 | 3 | 26 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Acetylcholine receptor subunit alpha | A, C | protein | 457 | Homo sapiens | P02708 (AlphaFold model) |
| Acetylcholine receptor subunit beta | E | protein | 503 | Homo sapiens | P11230 (AlphaFold model) |
| Acetylcholine receptor subunit delta | D | protein | 517 | Homo sapiens | Q07001 (AlphaFold model) |
| Acetylcholine receptor subunit epsilon | B | protein | 493 | Homo sapiens | Q04844 (AlphaFold model) |
| Fab1b heavy chain | F | protein | 264 | Homo sapiens | |
| Fab1b light chain | G | protein | 238 | Homo sapiens | |
Sequence of entity 1 (A, C), FASTA
>9DMK_1 Acetylcholine receptor subunit alpha (chains A, C)
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL
INVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDF
AIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINP
ESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLPLYFIVNVII
PCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLF
TMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKK
IFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSAIEGIKYIAETMKSDQESNNAAAEWK
YVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQQG
Sequence of entity 2 (E), FASTA
>9DMK_2 Acetylcholine receptor subunit beta (chains E)
MTPGALLMLLGALGAPLAPGVRGSEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLIL
AQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNND
GNFDVALDISVVVSSDGSVRWQPPGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVS
LQTGLGPDGQGHQEIHIHEGTFIENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLI
IRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPE
TSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRL
KRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFI
DGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTS
VGTLVIFLDATYHLPPPDPFPSR
Sequence of entity 3 (D), FASTA
>9DMK_3 Acetylcholine receptor subunit delta (chains D)
MEGPVLTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTL
SNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNND
GSFQISYSCNVLVYHYGFVYWLPPAIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEIT
LSLKQDAKENRTYPVEWIIIDPEGFTENGEWEIVHRPARVNVDPRAPLDSPSRQDITFYL
IIRRKPLFYIINILVPCVLISFMVNLVFYLPADSGEKTSVAISVLLAQSVFLLLISKRLP
ATSMAIPLIGKFLLFGMVLVTMVVVICVIVLNIHFRTPSTHVLSEGVKKLFLETLPELLH
MSRPAEDGPSPGALVRRSSSLGYISKAEEYFLLKSRSDLMFEKQSERHGLARRLTTARRP
PASSEQAQQELFNELKPAVDGANFIVNHMRDQNNYNEEKDSWNRVARTVDRLCLFVVTPV
MVVGTAWIFLQGVYNQPPPQPFPGDPYSYNVQDKRFI
Sequence of entity 4 (B), FASTA
>9DMK_4 Acetylcholine receptor subunit epsilon (chains B)
MARAPLGVLLLLGLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNL
ISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQF
GVAYDANVLVYEGGSVTWLPPAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTF
AVDNDGKTINKIDIDTEAYTENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRKP
LFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLS
VPLLGRFLIFVMVVATLIVMNCVIVLNVSQRTPTTHAMSPRLRHVLLELLPRLLGSPPPP
EAPRAASPPRRASSVGLLLRAEELILKKPRSELVFEGQRHRQGTWTAAFCQSLGAAAPEV
RCCVDAVNFVAESTRDQEATGEEVSDWVRMGNALDNICFWAALVLFSVGSSLIFLGAYFN
RVPDLPYAPCIQP
Sequence of entity 5 (F), FASTA
>9DMK_5 Fab1b heavy chain (chains F)
MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSAQVQLVQSGAEMKKPGSSVKVSCKASGGSF
GSYGIDWVRQAPGQGLEWMGGIMPKFDAPKYAEKFQGRLTITADRATNTAYMELSSLRFE
DTAIYYCARDEQPFYDSWRGLYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC
LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH
KPSNTKVDKKVEPKSCGSHHHHHH
Sequence of entity 6 (G), FASTA
>9DMK_6 Fab1b light chain (chains G)
MGWSCIILFLVATATGVHGDIVMTQSPLSLPVTPGEPASISCRSNQSLLHTKGYKYLNWY
LQRPGQSPQVLIYFASNRAPGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQIPF
TFGPGTKVDIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQS
GNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CLR | Cholesterol | C27 H46 O | 2 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
| POV | (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl… | C42 H82 N O8 P | 3 |
Primary citation
Autoimmune mechanisms elucidated through muscle acetylcholine receptor structures. Li, H., Pham, M.C., Teng, J. et al. Cell (2025) 188:2390-2406.e20. DOI 10.1016/j.cell.2025.03.004 · PubMed
Other PDB entries of the same protein (UniProt P02708 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9DMS 1.92 Å, Human muscle nAChR with fab6-bound
- 9DMG 2.05 Å, Human muscle nAChR apo state
- 9DMH 2.06 Å, Human muscle nAChR ACh-bound state
- 9DMQ 2.06 Å, Human muscle nAChR with fab3-bound
- 9DMV 2.13 Å, Human muscle nAChR with fab9-bound
- 9DMT 2.18 Å, Human muscle nAChR with fab7-bound
- 9DMJ 2.19 Å, Human muscle nAChR with two fab1b-bound
- 9YER 2.19 Å, Human muscle nAChR SCCMS eT264P ACh bound
- 9YE8 2.22 Å, Human muscle nAChR SCCMS eL269F ACh bound
- 4ZJS 2.23 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia Californica…
- 9DML 2.24 Å, Human muscle nAChR with fab2-bound
- 9YEI 2.36 Å, Human muscle nAChR SCCMS eL269F ACh, Reboxetine bound (lower 1)
Browse structure collections
About this viewer
MolViewer shows 9DMK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.