9DMS: Human muscle nAChR with fab6-bound
Human muscle nAChR with fab6-bound. Determined by electron microscopy at 1.92 Å resolution. Released 9 Apr 2025.
- Method
- Electron microscopy
- Resolution
- 1.92 Å
- Organism
- Homo sapiens
- Chains
- 7
- Atoms
- 20,425
- Mol. weight
- 340.87 kDa
- Ligands
- CLR, NAG, POV
- Released
- 9 Apr 2025
Explore 9DMS in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9DMS contains 96 α-helices and 129 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 16 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| β-strand | 29-44 | 16 | 1 |
| β-strand | 49-61 | 13 | 1 |
| α-helix | 69-72 | 4 | |
| β-strand | 77-80 | 4 | 1 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 2 |
| β-strand | 95 | 1 | 1 |
| β-strand | 101 | 1 | 2 |
| α-helix | 106-107 | 2 | |
| β-strand | 108-111 | 4 | 1 |
| β-strand | 115-118 | 4 | 1 |
| β-strand | 121-127 | 7 | 1 |
| β-strand | 139-148 | 10 | 2 |
| β-strand | 156-160 | 5 | 1 |
| β-strand | 166 | 1 | 1 |
| α-helix | 170-173 | 4 | |
| β-strand | 176-190 | 15 | 2 |
| β-strand | 193-209 | 17 | 2 |
| α-helix | 212-214 | 3 | |
| α-helix | 215-219 | 5 | |
| α-helix | 220-230 | 11 | |
| α-helix | 231-234 | 4 | |
| α-helix | 237-239 | 3 | |
| α-helix | 242-263 | 22 | |
| α-helix | 273-299 | 27 | |
| α-helix | 310-312 | 3 | |
| α-helix | 313-319 | 7 | |
| α-helix | 320-323 | 4 | |
| α-helix | 370-435 | 66 | |
Chain B: 16 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-12 | 10 | |
| β-strand | 29-44 | 16 | 13 |
| β-strand | 49-61 | 13 | 13 |
| α-helix | 63-65 | 3 | |
| α-helix | 69-72 | 4 | |
| β-strand | 77-80 | 4 | 13 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 14 |
| β-strand | 95 | 1 | 13 |
| α-helix | 106-107 | 2 | |
| β-strand | 108-111 | 4 | 13 |
| β-strand | 115-118 | 4 | 13 |
| β-strand | 121-127 | 7 | 13 |
| β-strand | 139-148 | 10 | 14 |
| β-strand | 156-160 | 5 | 13 |
| β-strand | 162 | 1 | 15 |
| β-strand | 168 | 1 | 15 |
| β-strand | 171 | 1 | 16 |
| β-strand | 173 | 1 | 13 |
| β-strand | 185-189 | 5 | 14 |
| β-strand | 191 | 1 | 16 |
| β-strand | 192-197 | 6 | 14 |
| β-strand | 207-218 | 12 | 14 |
| α-helix | 221-223 | 3 | |
| α-helix | 224-228 | 5 | |
| α-helix | 229-236 | 8 | |
| α-helix | 237-243 | 7 | |
| α-helix | 252-271 | 20 | |
| α-helix | 283-309 | 27 | |
| β-strand | 316 | 1 | 5 |
| α-helix | 320-324 | 5 | |
| α-helix | 325-329 | 5 | |
| α-helix | 330-333 | 4 | |
| α-helix | 398-458 | 61 | |
| α-helix | 461-463 | 3 | |
Chain C: 15 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| β-strand | 29-44 | 16 | 3 |
| β-strand | 49-61 | 13 | 3 |
| α-helix | 69-72 | 4 | |
| β-strand | 77-81 | 5 | 3 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 4 |
| β-strand | 95 | 1 | 3 |
| β-strand | 101 | 1 | 4 |
| β-strand | 107-111 | 5 | 3 |
| β-strand | 115-118 | 4 | 3 |
| β-strand | 121-127 | 7 | 3 |
| β-strand | 139-148 | 10 | 4 |
| β-strand | 156-160 | 5 | 3 |
| β-strand | 166 | 1 | 3 |
| α-helix | 170-173 | 4 | |
| β-strand | 176-190 | 15 | 4 |
| β-strand | 193-209 | 17 | 4 |
| α-helix | 212-214 | 3 | |
| α-helix | 215-219 | 5 | |
| α-helix | 220-230 | 11 | |
| α-helix | 231-234 | 4 | |
| α-helix | 237-239 | 3 | |
| α-helix | 242-263 | 22 | |
| α-helix | 273-299 | 27 | |
| α-helix | 310-312 | 3 | |
| α-helix | 313-319 | 7 | |
| α-helix | 320-322 | 3 | |
| β-strand | 328 | 1 | 5 |
| α-helix | 370-434 | 65 | |
Chain D: 18 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-8 | 7 | |
| α-helix | 9-14 | 6 | |
| β-strand | 31-46 | 16 | 9 |
| β-strand | 51-63 | 13 | 9 |
| α-helix | 65-67 | 3 | |
| α-helix | 71-73 | 3 | |
| β-strand | 79-82 | 4 | 9 |
| α-helix | 84-86 | 3 | |
| β-strand | 93-94 | 2 | 10 |
| β-strand | 97 | 1 | 9 |
| β-strand | 110-113 | 4 | 9 |
| β-strand | 117-120 | 4 | 9 |
| β-strand | 123-129 | 7 | 9 |
| β-strand | 141-149 | 9 | 10 |
| β-strand | 158-162 | 5 | 9 |
| β-strand | 164-167 | 4 | 11 |
| β-strand | 170-173 | 4 | 11 |
| β-strand | 176 | 1 | 12 |
| β-strand | 178 | 1 | 9 |
| α-helix | 184-187 | 4 | |
| β-strand | 190-194 | 5 | 10 |
| β-strand | 196 | 1 | 12 |
| β-strand | 197-201 | 5 | 10 |
| β-strand | 213-223 | 11 | 10 |
| α-helix | 226-228 | 3 | |
| α-helix | 229-233 | 5 | |
| α-helix | 234-241 | 8 | |
| α-helix | 242-247 | 6 | |
| α-helix | 251-253 | 3 | |
| α-helix | 256-275 | 20 | |
| α-helix | 287-313 | 27 | |
| α-helix | 324-327 | 4 | |
| α-helix | 328-333 | 6 | |
| α-helix | 334-337 | 4 | |
| α-helix | 340-343 | 4 | |
| α-helix | 409-472 | 64 | |
Chain E: 18 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| α-helix | 27-28 | 2 | |
| β-strand | 29-44 | 16 | 6 |
| β-strand | 49-66 | 18 | 6 |
| α-helix | 69-71 | 3 | |
| β-strand | 77-81 | 5 | 6 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 7 |
| β-strand | 95 | 1 | 6 |
| β-strand | 107-111 | 5 | 6 |
| β-strand | 113-118 | 6 | 6 |
| β-strand | 121-127 | 7 | 6 |
| β-strand | 139-148 | 10 | 7 |
| β-strand | 156-160 | 5 | 6 |
| β-strand | 171 | 1 | 8 |
| β-strand | 173 | 1 | 6 |
| β-strand | 180 | 1 | 6 |
| β-strand | 185-189 | 5 | 7 |
| β-strand | 191 | 1 | 8 |
| β-strand | 192-195 | 4 | 7 |
| α-helix | 196-198 | 3 | |
| β-strand | 211-220 | 10 | 7 |
| α-helix | 223-225 | 3 | |
| α-helix | 226-230 | 5 | |
| α-helix | 231-242 | 12 | |
| α-helix | 243-245 | 3 | |
| α-helix | 248-250 | 3 | |
| α-helix | 253-272 | 20 | |
| α-helix | 284-310 | 27 | |
| α-helix | 318-320 | 3 | |
| α-helix | 321-324 | 4 | |
| α-helix | 325-330 | 6 | |
| α-helix | 331-334 | 4 | |
| α-helix | 408-468 | 61 | |
| α-helix | 471-473 | 3 | |
Chain F: 7 helices, 24 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 34-38 | 5 | 17 |
| β-strand | 42-43 | 2 | 18 |
| β-strand | 49-56 | 8 | 17 |
| α-helix | 60-62 | 3 | |
| β-strand | 65-70 | 6 | 19 |
| β-strand | 76-83 | 8 | 19 |
| β-strand | 88-91 | 4 | 19 |
| α-helix | 93-95 | 3 | |
| β-strand | 99-103 | 5 | 17 |
| β-strand | 109-114 | 6 | 17 |
| α-helix | 119-121 | 3 | |
| β-strand | 123-130 | 8 | 19 |
| β-strand | 142-145 | 4 | 19 |
| β-strand | 149-151 | 3 | 19 |
| β-strand | 152-153 | 2 | 18 |
| α-helix | 156-158 | 3 | |
| β-strand | 159 | 1 | 20 |
| β-strand | 162-166 | 5 | 21 |
| β-strand | 177-187 | 11 | 21 |
| β-strand | 188 | 1 | 20 |
| β-strand | 193-196 | 4 | 22 |
| α-helix | 197-199 | 3 | |
| β-strand | 205-207 | 3 | 21 |
| α-helix | 208-210 | 3 | |
| β-strand | 211-212 | 2 | 21 |
| β-strand | 218-227 | 10 | 21 |
| α-helix | 228-230 | 3 | |
| β-strand | 236-241 | 6 | 22 |
| β-strand | 242 | 1 | 23 |
| β-strand | 247 | 1 | 23 |
| β-strand | 250-253 | 4 | 22 |
Chain G: 6 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 24 | 1 | 24 |
| β-strand | 28-31 | 4 | 25 |
| β-strand | 37-42 | 6 | 24 |
| α-helix | 46-48 | 3 | |
| β-strand | 52-56 | 5 | 25 |
| β-strand | 63-66 | 4 | 25 |
| β-strand | 67 | 1 | 26 |
| β-strand | 71 | 1 | 26 |
| β-strand | 80-85 | 6 | 24 |
| β-strand | 88-93 | 6 | 24 |
| β-strand | 103-110 | 8 | 25 |
| β-strand | 114-117 | 4 | 25 |
| β-strand | 121-125 | 5 | 25 |
| β-strand | 130 | 1 | 27 |
| α-helix | 131-132 | 2 | |
| β-strand | 133-137 | 5 | 28 |
| α-helix | 138-140 | 3 | |
| α-helix | 141-144 | 4 | |
| β-strand | 148-158 | 11 | 28 |
| β-strand | 159 | 1 | 27 |
| β-strand | 163-169 | 7 | 29 |
| β-strand | 173 | 1 | 29 |
| β-strand | 178-182 | 5 | 28 |
| α-helix | 183-186 | 4 | |
| β-strand | 192-201 | 10 | 28 |
| α-helix | 202-207 | 6 | |
| β-strand | 210-217 | 8 | 29 |
| β-strand | 224-229 | 6 | 29 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Acetylcholine receptor subunit alpha | A, C | protein | 457 | Homo sapiens | P02708 (AlphaFold model) |
| Acetylcholine receptor subunit beta | E | protein | 503 | Homo sapiens | P11230 (AlphaFold model) |
| Acetylcholine receptor subunit delta | D | protein | 517 | Homo sapiens | Q07001 (AlphaFold model) |
| Acetylcholine receptor subunit epsilon | B | protein | 493 | Homo sapiens | Q04844 (AlphaFold model) |
| Fab6 heavy chain | F | protein | 290 | Homo sapiens | |
| Fab6 light chain | G | protein | 233 | Homo sapiens | |
Sequence of entity 1 (A, C), FASTA
>9DMS_1 Acetylcholine receptor subunit alpha (chains A, C)
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL
INVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDF
AIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINP
ESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLPLYFIVNVII
PCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLF
TMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKK
IFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSAIEGIKYIAETMKSDQESNNAAAEWK
YVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQQG
Sequence of entity 2 (E), FASTA
>9DMS_2 Acetylcholine receptor subunit beta (chains E)
MTPGALLMLLGALGAPLAPGVRGSEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLIL
AQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNND
GNFDVALDISVVVSSDGSVRWQPPGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVS
LQTGLGPDGQGHQEIHIHEGTFIENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLI
IRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPE
TSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRL
KRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFI
DGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTS
VGTLVIFLDATYHLPPPDPFPSR
Sequence of entity 3 (D), FASTA
>9DMS_3 Acetylcholine receptor subunit delta (chains D)
MEGPVLTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTL
SNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNND
GSFQISYSCNVLVYHYGFVYWLPPAIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEIT
LSLKQDAKENRTYPVEWIIIDPEGFTENGEWEIVHRPARVNVDPRAPLDSPSRQDITFYL
IIRRKPLFYIINILVPCVLISFMVNLVFYLPADSGEKTSVAISVLLAQSVFLLLISKRLP
ATSMAIPLIGKFLLFGMVLVTMVVVICVIVLNIHFRTPSTHVLSEGVKKLFLETLPELLH
MSRPAEDGPSPGALVRRSSSLGYISKAEEYFLLKSRSDLMFEKQSERHGLARRLTTARRP
PASSEQAQQELFNELKPAVDGANFIVNHMRDQNNYNEEKDSWNRVARTVDRLCLFVVTPV
MVVGTAWIFLQGVYNQPPPQPFPGDPYSYNVQDKRFI
Sequence of entity 4 (B), FASTA
>9DMS_4 Acetylcholine receptor subunit epsilon (chains B)
MARAPLGVLLLLGLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNL
ISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQF
GVAYDANVLVYEGGSVTWLPPAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTF
AVDNDGKTINKIDIDTEAYTENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRKP
LFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLS
VPLLGRFLIFVMVVATLIVMNCVIVLNVSQRTPTTHAMSPRLRHVLLELLPRLLGSPPPP
EAPRAASPPRRASSVGLLLRAEELILKKPRSELVFEGQRHRQGTWTAAFCQSLGAAAPEV
RCCVDAVNFVAESTRDQEATGEEVSDWVRMGNALDNICFWAALVLFSVGSSLIFLGAYFN
RVPDLPYAPCIQP
Sequence of entity 5 (F), FASTA
>9DMS_5 Fab6 heavy chain (chains F)
MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSAEVQLLESGGGLVQPGGSLRLSCAASGFTF
SDYAMNWVRQAPGRGLEWVSSFSNSGGTTYYTDSVKGRFTISRDYSRNTLYLQMNNLRAE
DTAVYYCAKALTRFYGGNIYNFDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV
NHKPSNTKVDKKVEPKSCGSDYKDHDGDYKDHDIDYKDDDDKHHHHHHHH
Sequence of entity 6 (G), FASTA
>9DMS_6 Fab6 light chain (chains G)
MGWSCIILFLVATATGVHSSYELTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQ
APVLVVYDNSDRPSGIPERLSGSNSGNTATLTISGVEAGDEADYYCQVWDSNSDVVFGGG
TKLTVLRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE
SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CLR | Cholesterol | C27 H46 O | 5 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
| POV | (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl… | C42 H82 N O8 P | 4 |
Primary citation
Autoimmune mechanisms elucidated through muscle acetylcholine receptor structures. Li, H., Pham, M.C., Teng, J. et al. Cell (2025) 188:2390-2406.e20. DOI 10.1016/j.cell.2025.03.004 · PubMed
Other PDB entries of the same protein (UniProt P02708 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9DMG 2.05 Å, Human muscle nAChR apo state
- 9DMH 2.06 Å, Human muscle nAChR ACh-bound state
- 9DMQ 2.06 Å, Human muscle nAChR with fab3-bound
- 9DMV 2.13 Å, Human muscle nAChR with fab9-bound
- 9DMT 2.18 Å, Human muscle nAChR with fab7-bound
- 9DMJ 2.19 Å, Human muscle nAChR with two fab1b-bound
- 9YER 2.19 Å, Human muscle nAChR SCCMS eT264P ACh bound
- 9YE8 2.22 Å, Human muscle nAChR SCCMS eL269F ACh bound
- 4ZJS 2.23 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia Californica…
- 9DML 2.24 Å, Human muscle nAChR with fab2-bound
- 9YEI 2.36 Å, Human muscle nAChR SCCMS eL269F ACh, Reboxetine bound (lower 1)
- 9YET 2.36 Å, Human muscle nAChR SCCMS eT264P ACh, Reboxetine bound
Browse structure collections
About this viewer
MolViewer shows 9DMS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.