9DMS: Human muscle nAChR with fab6-bound

Human muscle nAChR with fab6-bound. Determined by electron microscopy at 1.92 Å resolution. Released 9 Apr 2025.

Method: Electron microscopy
Resolution: 1.92 Å
Organism: Homo sapiens
Chains: 7
Atoms: 20,425
Mol. weight: 340.87 kDa
Ligands: CLR, NAG, POV
Released: 9 Apr 2025

Explore 9DMS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9DMS contains 96 α-helices and 129 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
β-strand	29-44	16	1
β-strand	49-61	13	1
α-helix	69-72	4
β-strand	77-80	4	1
α-helix	82-84	3
β-strand	90-92	3	2
β-strand	95	1	1
β-strand	101	1	2
α-helix	106-107	2
β-strand	108-111	4	1
β-strand	115-118	4	1
β-strand	121-127	7	1
β-strand	139-148	10	2
β-strand	156-160	5	1
β-strand	166	1	1
α-helix	170-173	4
β-strand	176-190	15	2
β-strand	193-209	17	2
α-helix	212-214	3
α-helix	215-219	5
α-helix	220-230	11
α-helix	231-234	4
α-helix	237-239	3
α-helix	242-263	22
α-helix	273-299	27
α-helix	310-312	3
α-helix	313-319	7
α-helix	320-323	4
α-helix	370-435	66

Chain B: 16 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	3-12	10
β-strand	29-44	16	13
β-strand	49-61	13	13
α-helix	63-65	3
α-helix	69-72	4
β-strand	77-80	4	13
α-helix	82-84	3
β-strand	90-92	3	14
β-strand	95	1	13
α-helix	106-107	2
β-strand	108-111	4	13
β-strand	115-118	4	13
β-strand	121-127	7	13
β-strand	139-148	10	14
β-strand	156-160	5	13
β-strand	162	1	15
β-strand	168	1	15
β-strand	171	1	16
β-strand	173	1	13
β-strand	185-189	5	14
β-strand	191	1	16
β-strand	192-197	6	14
β-strand	207-218	12	14
α-helix	221-223	3
α-helix	224-228	5
α-helix	229-236	8
α-helix	237-243	7
α-helix	252-271	20
α-helix	283-309	27
β-strand	316	1	5
α-helix	320-324	5
α-helix	325-329	5
α-helix	330-333	4
α-helix	398-458	61
α-helix	461-463	3

Chain C: 15 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
β-strand	29-44	16	3
β-strand	49-61	13	3
α-helix	69-72	4
β-strand	77-81	5	3
α-helix	82-84	3
β-strand	90-92	3	4
β-strand	95	1	3
β-strand	101	1	4
β-strand	107-111	5	3
β-strand	115-118	4	3
β-strand	121-127	7	3
β-strand	139-148	10	4
β-strand	156-160	5	3
β-strand	166	1	3
α-helix	170-173	4
β-strand	176-190	15	4
β-strand	193-209	17	4
α-helix	212-214	3
α-helix	215-219	5
α-helix	220-230	11
α-helix	231-234	4
α-helix	237-239	3
α-helix	242-263	22
α-helix	273-299	27
α-helix	310-312	3
α-helix	313-319	7
α-helix	320-322	3
β-strand	328	1	5
α-helix	370-434	65

Chain D: 18 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7
α-helix	9-14	6
β-strand	31-46	16	9
β-strand	51-63	13	9
α-helix	65-67	3
α-helix	71-73	3
β-strand	79-82	4	9
α-helix	84-86	3
β-strand	93-94	2	10
β-strand	97	1	9
β-strand	110-113	4	9
β-strand	117-120	4	9
β-strand	123-129	7	9
β-strand	141-149	9	10
β-strand	158-162	5	9
β-strand	164-167	4	11
β-strand	170-173	4	11
β-strand	176	1	12
β-strand	178	1	9
α-helix	184-187	4
β-strand	190-194	5	10
β-strand	196	1	12
β-strand	197-201	5	10
β-strand	213-223	11	10
α-helix	226-228	3
α-helix	229-233	5
α-helix	234-241	8
α-helix	242-247	6
α-helix	251-253	3
α-helix	256-275	20
α-helix	287-313	27
α-helix	324-327	4
α-helix	328-333	6
α-helix	334-337	4
α-helix	340-343	4
α-helix	409-472	64

Chain E: 18 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
α-helix	27-28	2
β-strand	29-44	16	6
β-strand	49-66	18	6
α-helix	69-71	3
β-strand	77-81	5	6
α-helix	82-84	3
β-strand	90-92	3	7
β-strand	95	1	6
β-strand	107-111	5	6
β-strand	113-118	6	6
β-strand	121-127	7	6
β-strand	139-148	10	7
β-strand	156-160	5	6
β-strand	171	1	8
β-strand	173	1	6
β-strand	180	1	6
β-strand	185-189	5	7
β-strand	191	1	8
β-strand	192-195	4	7
α-helix	196-198	3
β-strand	211-220	10	7
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-242	12
α-helix	243-245	3
α-helix	248-250	3
α-helix	253-272	20
α-helix	284-310	27
α-helix	318-320	3
α-helix	321-324	4
α-helix	325-330	6
α-helix	331-334	4
α-helix	408-468	61
α-helix	471-473	3

Chain F: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	34-38	5	17
β-strand	42-43	2	18
β-strand	49-56	8	17
α-helix	60-62	3
β-strand	65-70	6	19
β-strand	76-83	8	19
β-strand	88-91	4	19
α-helix	93-95	3
β-strand	99-103	5	17
β-strand	109-114	6	17
α-helix	119-121	3
β-strand	123-130	8	19
β-strand	142-145	4	19
β-strand	149-151	3	19
β-strand	152-153	2	18
α-helix	156-158	3
β-strand	159	1	20
β-strand	162-166	5	21
β-strand	177-187	11	21
β-strand	188	1	20
β-strand	193-196	4	22
α-helix	197-199	3
β-strand	205-207	3	21
α-helix	208-210	3
β-strand	211-212	2	21
β-strand	218-227	10	21
α-helix	228-230	3
β-strand	236-241	6	22
β-strand	242	1	23
β-strand	247	1	23
β-strand	250-253	4	22

Chain G: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	24	1	24
β-strand	28-31	4	25
β-strand	37-42	6	24
α-helix	46-48	3
β-strand	52-56	5	25
β-strand	63-66	4	25
β-strand	67	1	26
β-strand	71	1	26
β-strand	80-85	6	24
β-strand	88-93	6	24
β-strand	103-110	8	25
β-strand	114-117	4	25
β-strand	121-125	5	25
β-strand	130	1	27
α-helix	131-132	2
β-strand	133-137	5	28
α-helix	138-140	3
α-helix	141-144	4
β-strand	148-158	11	28
β-strand	159	1	27
β-strand	163-169	7	29
β-strand	173	1	29
β-strand	178-182	5	28
α-helix	183-186	4
β-strand	192-201	10	28
α-helix	202-207	6
β-strand	210-217	8	29
β-strand	224-229	6	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acetylcholine receptor subunit alpha	A, C	protein	457	Homo sapiens	P02708 (AlphaFold model)
Acetylcholine receptor subunit beta	E	protein	503	Homo sapiens	P11230 (AlphaFold model)
Acetylcholine receptor subunit delta	D	protein	517	Homo sapiens	Q07001 (AlphaFold model)
Acetylcholine receptor subunit epsilon	B	protein	493	Homo sapiens	Q04844 (AlphaFold model)
Fab6 heavy chain	F	protein	290	Homo sapiens
Fab6 light chain	G	protein	233	Homo sapiens

Sequence of entity 1 (A, C), FASTA

>9DMS_1 Acetylcholine receptor subunit alpha (chains A, C)
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL
INVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDF
AIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINP
ESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLPLYFIVNVII
PCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLF
TMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKK
IFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSAIEGIKYIAETMKSDQESNNAAAEWK
YVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQQG

Sequence of entity 2 (E), FASTA

>9DMS_2 Acetylcholine receptor subunit beta (chains E)
MTPGALLMLLGALGAPLAPGVRGSEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLIL
AQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNND
GNFDVALDISVVVSSDGSVRWQPPGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVS
LQTGLGPDGQGHQEIHIHEGTFIENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLI
IRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPE
TSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRL
KRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFI
DGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTS
VGTLVIFLDATYHLPPPDPFPSR

Sequence of entity 3 (D), FASTA

>9DMS_3 Acetylcholine receptor subunit delta (chains D)
MEGPVLTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTL
SNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNND
GSFQISYSCNVLVYHYGFVYWLPPAIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEIT
LSLKQDAKENRTYPVEWIIIDPEGFTENGEWEIVHRPARVNVDPRAPLDSPSRQDITFYL
IIRRKPLFYIINILVPCVLISFMVNLVFYLPADSGEKTSVAISVLLAQSVFLLLISKRLP
ATSMAIPLIGKFLLFGMVLVTMVVVICVIVLNIHFRTPSTHVLSEGVKKLFLETLPELLH
MSRPAEDGPSPGALVRRSSSLGYISKAEEYFLLKSRSDLMFEKQSERHGLARRLTTARRP
PASSEQAQQELFNELKPAVDGANFIVNHMRDQNNYNEEKDSWNRVARTVDRLCLFVVTPV
MVVGTAWIFLQGVYNQPPPQPFPGDPYSYNVQDKRFI

Sequence of entity 4 (B), FASTA

>9DMS_4 Acetylcholine receptor subunit epsilon (chains B)
MARAPLGVLLLLGLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNL
ISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQF
GVAYDANVLVYEGGSVTWLPPAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTF
AVDNDGKTINKIDIDTEAYTENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRKP
LFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLS
VPLLGRFLIFVMVVATLIVMNCVIVLNVSQRTPTTHAMSPRLRHVLLELLPRLLGSPPPP
EAPRAASPPRRASSVGLLLRAEELILKKPRSELVFEGQRHRQGTWTAAFCQSLGAAAPEV
RCCVDAVNFVAESTRDQEATGEEVSDWVRMGNALDNICFWAALVLFSVGSSLIFLGAYFN
RVPDLPYAPCIQP

Sequence of entity 5 (F), FASTA

>9DMS_5 Fab6 heavy chain (chains F)
MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSAEVQLLESGGGLVQPGGSLRLSCAASGFTF
SDYAMNWVRQAPGRGLEWVSSFSNSGGTTYYTDSVKGRFTISRDYSRNTLYLQMNNLRAE
DTAVYYCAKALTRFYGGNIYNFDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV
NHKPSNTKVDKKVEPKSCGSDYKDHDGDYKDHDIDYKDDDDKHHHHHHHH

Sequence of entity 6 (G), FASTA

>9DMS_6 Fab6 light chain (chains G)
MGWSCIILFLVATATGVHSSYELTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQ
APVLVVYDNSDRPSGIPERLSGSNSGNTATLTISGVEAGDEADYYCQVWDSNSDVVFGGG
TKLTVLRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE
SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Ligands and cofactors

ID	Name	Formula	Copies
CLR	Cholesterol	C27 H46 O	5
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	4

Primary citation

Autoimmune mechanisms elucidated through muscle acetylcholine receptor structures. Li, H., Pham, M.C., Teng, J. et al. Cell (2025) 188:2390-2406.e20. DOI 10.1016/j.cell.2025.03.004 · PubMed

Other PDB entries of the same protein (UniProt P02708 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DMG 2.05 Å, Human muscle nAChR apo state
9DMH 2.06 Å, Human muscle nAChR ACh-bound state
9DMQ 2.06 Å, Human muscle nAChR with fab3-bound
9DMV 2.13 Å, Human muscle nAChR with fab9-bound
9DMT 2.18 Å, Human muscle nAChR with fab7-bound
9DMJ 2.19 Å, Human muscle nAChR with two fab1b-bound
9YER 2.19 Å, Human muscle nAChR SCCMS eT264P ACh bound
9YE8 2.22 Å, Human muscle nAChR SCCMS eL269F ACh bound
4ZJS 2.23 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia Californica…
9DML 2.24 Å, Human muscle nAChR with fab2-bound
9YEI 2.36 Å, Human muscle nAChR SCCMS eL269F ACh, Reboxetine bound (lower 1)
9YET 2.36 Å, Human muscle nAChR SCCMS eT264P ACh, Reboxetine bound

Browse structure collections

About this viewer

MolViewer shows 9DMS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.