9FJI: Two PLK1 PBD proteins

Two PLK1 PBD proteins bound to CENP-U(58-114) phosphorylated at Thr98. Determined by X-ray diffraction at 2.1 Å resolution. Released 24 Sept 2025.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,108
Mol. weight: 67.29 kDa
Released: 24 Sept 2025

Explore 9FJI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9FJI contains 20 α-helices and 30 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	372-386	15
α-helix	397-400	4
β-strand	401	1	1
α-helix	403-405	3
β-strand	411-417	7	2
β-strand	422-427	6	2
β-strand	432-436	5	2
β-strand	441-444	4	2
β-strand	450-454	5	2
β-strand	460-464	5	2
α-helix	470-472	3
α-helix	473-489	17
β-strand	490	1	3
α-helix	507-509	3
β-strand	511-516	6	1
β-strand	520-525	6	1
β-strand	530-534	5	1
β-strand	540-544	5	1
β-strand	549-553	5	1
β-strand	559-563	5	1
α-helix	564-570	7
α-helix	574-592	19

Chain B: 9 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	372-386	15
α-helix	397-400	4
β-strand	401	1	4
α-helix	403-405	3
β-strand	411-417	7	5
β-strand	422-427	6	5
β-strand	432-436	5	5
β-strand	441-444	4	5
β-strand	450-454	5	5
β-strand	460-464	5	5
α-helix	473-489	17
α-helix	498-499	2
α-helix	507-509	3
β-strand	511-516	6	4
β-strand	520-525	6	4
β-strand	530-534	5	4
β-strand	540-544	5	4
α-helix	545-547	3
β-strand	549-553	5	4
β-strand	559-563	5	4
α-helix	564-570	7
α-helix	574-592	19

Chain C: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	75-76	2	2
β-strand	79	1	3
α-helix	80-82	3
α-helix	84-93	10
β-strand	96	1	5
α-helix	98-100	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase PLK1	A, B	protein	261	Homo sapiens	P53350 (AlphaFold model)
Centromere protein U	C	protein	59	Homo sapiens	Q71F23 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9FJI_1 Serine/threonine-protein kinase PLK1 (chains A, B)
GSKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAED
PACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESY
LTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAII
LHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRY
ARTMVDKLLSSRSASNRLKAS

Sequence of entity 2 (C), FASTA

>9FJI_2 Centromere protein U (chains C)
GSLGENEKDEETYETFDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNE

Primary citation

Two PLK1 PBD proteins bound to CENP-U(58-114) phosphorylated at Thr78 and Thr98. Ren, L., Musacchio, A. To be published.

Other PDB entries of the same protein (UniProt P53350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4X9R 1.4 Å, PLK-1 polo-box domain in complex with Bioactive Imidazolium-containing phosphopeptide…
3P34 1.4 Å, Polo-like kinase I Polo-box domain in complex with MQSpTPL phosphopeptide
3Q1I 1.4 Å, Polo-like kinase I Polo-box domain in complex with FMPPPMSpSM phosphopeptide from TCERG1
4X9V 1.43 Å, PLK-1 polo-box domain in complex with Bioactive Imidazolium-containing phosphopeptide…
4O6W 1.45 Å, Peptide-Based Inhibitors of Plk1 Polo-box Domain
6AX4 1.45 Å, Plk-1 polo-box domain in complex with histidine N(tau)-cyclized Macrocycle 5b.
3RQ7 1.55 Å, Polo-like kinase 1 Polo box domain in complex with a C6H5(CH2)8-derivatized peptide…
4DFW 1.55 Å, Oxime-based Post Solid-phase Peptide Diversification: Identification of High Affinity…
3FVH 1.58 Å, Polo-like kinase 1 Polo box domain in complex with Ac-LHSpTA-NH2 peptide
4LKL 1.58 Å, Crystal structure of Plk1 Polo-box domain in complex with PL-55
3P36 1.59 Å, Polo-like kinase I Polo-box domain in complex with DPPLHSpTA phosphopeptide from PBIP1
4RCP 1.6 Å, Crystal structure of Plk1 Polo-box domain in complex with PL-2

Browse structure collections

About this viewer

MolViewer shows 9FJI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.