9FXZ: Galectin-8

Galectin-8 N-terminal carbohydrate recognition domain in complex with 4-(bromophenyl)phthalazinone D-galactal ligand. Determined by X-ray diffraction at 1.3 Å resolution. Released 16 Jul 2025.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,803
Mol. weight: 72.66 kDa
Ligands: V19
Released: 16 Jul 2025

Explore 9FXZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9FXZ contains 3 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	1
β-strand	19-22	4	2
β-strand	32-38	7	1
β-strand	45-51	7	2
α-helix	60-61	2
β-strand	62-69	8	2
β-strand	75-82	8	2
β-strand	85-86	2	2
β-strand	90-92	3	2
β-strand	102-109	8	1
β-strand	113-118	6	1
β-strand	121-127	7	1
α-helix	132-134	3
β-strand	137-142	6	2
β-strand	145-152	8	1

Chain B: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	3
β-strand	19-22	4	4
β-strand	32-38	7	3
β-strand	45-56	12	4
β-strand	59-69	11	4
β-strand	75-82	8	4
β-strand	85-86	2	4
β-strand	90-92	3	4
β-strand	102-109	8	3
β-strand	113-118	6	3
β-strand	121-127	7	3
α-helix	132-134	3
β-strand	137-142	6	4
β-strand	145-152	8	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Galectin-8	A, B	protein	317	Homo sapiens	O00214 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9FXZ_1 Galectin-8 (chains A, B)
MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRA
DVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNG
KHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGT
PQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFV
RNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSI
DTLEINGDIHLLEVRSW

Ligands and cofactors

ID	Name	Formula	Copies
V19	4-(4-bromophenyl)-2-[[(2~{R},3~{R},4~{R})-2-(hydroxymethyl)-3-oxidanyl-3,4-dihy…	C21 H19 Br N2 O5	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Galectin-8N-Selective 4-Halophenylphthalazinone-Galactals Double pi-Stack in a Unique Pocket. van Klaveren, S., Hassan, M., Hakansson, M. et al. ACS Med Chem Lett (2024) 15:1319-1324. DOI 10.1021/acsmedchemlett.4c00212 · PubMed

Other PDB entries of the same protein (UniProt O00214 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GZC 1.08 Å, Crystal structure of Galectin-8 N-CRD with part of linker
9FYJ 1.08 Å, N-terminal domain of human galectin-8 in complex with an alpha-galactoside ligand
5GZD 1.19 Å, Galectin-8 N-terminal domain carbohydrate recognition domain
5GZE 1.32 Å, Galectin-8 N-terminal domain carbohydrate recognition domain
3AP9 1.33 Å, Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in…
6Z6Y 1.34 Å, Galectin-8 N-terminal domain in complex with a sulfatide mimicking a sphingolipid
7ALS 1.35 Å, Alpha and beta Lactose isomer structure of Galectin 8, N-terminal domain
4BMB 1.35 Å, Crystal structure of the N terminal domain of human Galectin 8
31ML 1.5 Å, Crystal structure of the complex of galectin-8N-Methyl 2,6-anhydro-3-deoxy-3-S-(b-D-galac…
7P1M 1.52 Å, Galectin-8 N-terminal carbohydrate recognition domain in complex with benzimidazole…
3AP7 1.53 Å, Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in…
3AP6 1.58 Å, Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in…

Browse structure collections

About this viewer

MolViewer shows 9FXZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.