9GU2: Acetylcholine receptor subunit alpha

Human adult muscle nAChR in desensitised state in nanodisc with 100 uM acetylcholine. Determined by electron microscopy at 2.73 Å resolution. Released 14 May 2025.

Method: Electron microscopy
Resolution: 2.73 Å
Organisms: Homo sapiens, Aequorea victoria, Rattus norvegicus
Chains: 9
Atoms: 21,623
Mol. weight: 392.4 kDa
Ligands: CU, NAG, ACH
Released: 14 May 2025

Explore 9GU2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9GU2 contains 106 α-helices and 173 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-11	9
β-strand	29-44	16	1
β-strand	49-61	13	1
α-helix	63-65	3
α-helix	69-72	4
β-strand	77-81	5	1
β-strand	90-92	3	2
β-strand	95	1	1
β-strand	101	1	2
α-helix	106	1
β-strand	107-111	5	1
β-strand	115-118	4	1
β-strand	121-127	7	1
β-strand	139-148	10	2
β-strand	156-160	5	1
β-strand	166	1	1
β-strand	171	1	1
β-strand	176-188	13	2
β-strand	198-209	12	2
α-helix	212-214	3
α-helix	215-219	5
α-helix	220-231	12
α-helix	232-234	3
α-helix	237-239	3
α-helix	242-263	22
α-helix	273-299	27
α-helix	307-309	3
α-helix	310-313	4
α-helix	314-319	6
α-helix	394-425	32

Chain B: 18 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11
α-helix	27-28	2
β-strand	29-44	16	3
β-strand	49-61	13	3
α-helix	63-65	3
β-strand	77-80	4	3
α-helix	82-84	3
β-strand	90-92	3	4
β-strand	95	1	3
α-helix	106-107	2
β-strand	108-111	4	3
β-strand	115-118	4	3
β-strand	121-127	7	3
β-strand	139-148	10	4
β-strand	156-160	5	3
α-helix	161-163	3
β-strand	171	1	5
β-strand	173	1	3
β-strand	180	1	3
β-strand	185-189	5	4
β-strand	191	1	5
β-strand	192-195	4	4
β-strand	211-220	10	4
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-242	12
α-helix	243-245	3
α-helix	248-250	3
α-helix	253-274	22
α-helix	284-310	27
α-helix	321-324	4
α-helix	325-330	6
α-helix	331-335	5
α-helix	432-469	38
α-helix	471-473	3

Chain C: 5 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	16
β-strand	10-13	4	17
β-strand	19-25	7	16
β-strand	33-38	6	17
β-strand	45-49	5	17
β-strand	53-54	2	17
α-helix	55	1
β-strand	62-67	6	16
β-strand	70-75	6	16
α-helix	80-82	3
β-strand	85-90	6	17
β-strand	96-97	2	17
β-strand	101-105	5	17
β-strand	110	1	18
β-strand	113-117	5	19
α-helix	118-120	3
α-helix	121-125	5
β-strand	128	1	20
β-strand	131-138	8	19
β-strand	139	1	18
β-strand	143-149	7	21
β-strand	152-154	3	21
β-strand	158-162	5	19
β-strand	172-178	7	19
β-strand	181	1	20
α-helix	182-186	5
β-strand	190-197	8	21
β-strand	204-209	6	21

Chain D: 21 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	3-9	7
α-helix	10-14	5
α-helix	30	1
β-strand	31-46	16	6
β-strand	51-63	13	6
α-helix	65-67	3
α-helix	71-74	4
β-strand	79-82	4	6
β-strand	92-94	3	7
β-strand	97	1	6
α-helix	108-109	2
β-strand	110-113	4	6
β-strand	117-120	4	6
β-strand	123-129	7	6
β-strand	141-150	10	7
β-strand	158-162	5	6
α-helix	163	1
β-strand	164-167	4	8
β-strand	170-173	4	8
β-strand	176	1	9
β-strand	178	1	6
β-strand	185	1	6
β-strand	190-194	5	7
β-strand	196	1	9
β-strand	197-201	5	7
α-helix	210-212	3
β-strand	213-223	11	7
α-helix	226-228	3
α-helix	229-233	5
α-helix	234-241	8
α-helix	242-244	3
α-helix	245-248	4
α-helix	251-253	3
α-helix	256-277	22
α-helix	287-313	27
α-helix	324-327	4
α-helix	328-333	6
α-helix	334-337	4
α-helix	431-472	42
α-helix	490-492	3

Chain E: 18 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	3-12	10
β-strand	29-44	16	10
β-strand	49-61	13	10
α-helix	63-65	3
α-helix	69-71	3
β-strand	77-80	4	10
α-helix	82-84	3
β-strand	90-92	3	11
β-strand	95	1	10
α-helix	106-107	2
β-strand	108-111	4	10
β-strand	115-118	4	10
β-strand	121-127	7	10
β-strand	139-148	10	11
β-strand	156-160	5	10
β-strand	162	1	12
β-strand	168	1	12
β-strand	171	1	13
β-strand	173	1	10
β-strand	185-189	5	11
β-strand	191	1	13
β-strand	192-197	6	11
α-helix	204-206	3
β-strand	207-218	12	11
α-helix	221-223	3
α-helix	224-228	5
α-helix	229-238	10
α-helix	239-243	5
α-helix	252-273	22
α-helix	283-309	27
α-helix	317-319	3
α-helix	320-324	5
α-helix	325-329	5
α-helix	421-459	39
α-helix	461-464	4
α-helix	468-469	2

Chain F: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	22
β-strand	11-12	2	23
β-strand	18-25	8	22
β-strand	33-40	8	17
β-strand	46-51	6	17
β-strand	57-59	3	17
β-strand	67-72	6	22
β-strand	77-82	6	22
α-helix	87-89	3
β-strand	91-101	11	17
β-strand	104-110	7	17
β-strand	114-116	3	17
β-strand	117-118	2	23
α-helix	121-123	3
β-strand	124	1	24
α-helix	125-126	2
β-strand	127-131	5	25
β-strand	143-150	8	25
β-strand	153	1	24
β-strand	158-161	4	26
α-helix	163-166	4
β-strand	170-172	3	25
α-helix	173-175	3
β-strand	176-178	3	25
β-strand	181-190	10	25
β-strand	201-206	6	26
β-strand	211-216	6	26

Chain G: 5 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	27
β-strand	10-13	4	28
β-strand	19-25	7	27
β-strand	33-38	6	28
β-strand	45-49	5	28
β-strand	53-54	2	28
α-helix	55	1
β-strand	62-67	6	27
β-strand	70-75	6	27
α-helix	80-82	3
β-strand	85-90	6	28
β-strand	96-97	2	28
β-strand	101-105	5	28
β-strand	110	1	29
β-strand	113-117	5	30
α-helix	118-120	3
α-helix	121-124	4
β-strand	128	1	31
β-strand	131-138	8	30
β-strand	139	1	29
β-strand	143-149	7	32
β-strand	152-154	3	32
β-strand	158-162	5	30
β-strand	172-178	7	30
β-strand	181	1	31
α-helix	182-186	5
β-strand	190-197	8	32
β-strand	204-209	6	32

Chain H: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	33
β-strand	11-12	2	34
β-strand	18-25	8	33
β-strand	33-40	8	28
β-strand	46-51	6	28
β-strand	57-59	3	28
β-strand	67-72	6	33
β-strand	77-82	6	33
α-helix	87-89	3
β-strand	91-101	11	28
β-strand	104-110	7	28
β-strand	114-116	3	28
β-strand	117-118	2	34
α-helix	121-123	3
β-strand	124	1	35
α-helix	125-126	2
β-strand	127-131	5	36
β-strand	143-152	10	36
β-strand	153	1	35
β-strand	158-161	4	37
α-helix	163-166	4
β-strand	170-178	9	36
β-strand	181-190	10	36
β-strand	201-206	6	37
β-strand	211-216	6	37

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acetylcholine receptor subunit alpha	A, L	protein	437	Homo sapiens	P02708 (AlphaFold model)
Acetylcholine receptor subunit beta	B	protein	478	Homo sapiens	P11230 (AlphaFold model)
Acetylcholine receptor subunit delta	D	protein	496	Homo sapiens	Q07001 (AlphaFold model)
Acetylcholine receptor subunit epsilon,Green fluorescent protein	E	protein	721	Homo sapiens, Aequorea victoria	Q04844 (AlphaFold model)
Fab35 light chain	C, G	protein	213	Rattus norvegicus
Fab35 heavy chain	F, H	protein	219	Rattus norvegicus

Sequence of entity 1 (A, L), FASTA

>9GU2_1 Acetylcholine receptor subunit alpha (chains A, L)
SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQQW
VDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTP
PAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKE
SRGWKHSVTYSCCPDTPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSG
EKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHH
RSPSTHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPM
GFHSPLIKHPEVKSAIEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCII
GTLAVFAGRLIELNQQG

Sequence of entity 2 (B), FASTA

>9GU2_2 Acetylcholine receptor subunit beta (chains B)
SEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLILAQLISLNEKDEEMSTKVYLDLEW
TDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNNDGNFDVALDISVVVSSDGSVRWQP
PGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVSLQTGLGPDGQGHQEIHIHEGTFI
ENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLIIRRKPLFYLVNVIAPCILITLLA
IFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPETSLSVPIIIKYLMFTMVLVTFSV
ILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRLKRPKPERDLMPEPPHCSSPGSGW
GRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFIDGPNRAVALLPELREVVSSISYI
ARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTSVGTLVIFLDATYHLPPPDPFP

Sequence of entity 3 (D), FASTA

>9GU2_3 Acetylcholine receptor subunit delta (chains D)
LNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTNVWIEH
GWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCNVLVYHYGFVYW
LPPAIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEITLSLKQDAKENRTYPVEWIIID
PEGFTENGEWEIVHRPARVNVDPRAPLDSPSRQDITFYLIIRRKPLFYIINILVPCVLIS
FMVNLVFYLPADSGEKTSVAISVLLAQSVFLLLISKRLPATSMAIPLIGKFLLFGMVLVT
MVVVICVIVLNIHFRTPSTHVLSEGVKKLFLETLPELLHMSRPAEDGPSPGALVRRSSSL
GYISKAEEYFLLKSRSDLMFEKQSERHGLARRLTTARRPPASSEQAQQELFNELKPAVDG
ANFIVNHMRDQNNYNEEKDSWNRVARTVDRLCLFVVTPVMVVGTAWIFLQGVYNQPPPQP
FPGDPYSYNVQDKRFI

Sequence of entity 4 (E), FASTA

>9GU2_4 Acetylcholine receptor subunit epsilon,Green fluorescent protein (chains E)
KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDW
QDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLVYEGGSVTWLP
PAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTFAVDNDGKTINKIDIDTEAYT
ENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRKPLFYVINIIVPCVLISGLVLL
AYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLSVPLLGRFLIFVMVVATLIVM
NCVIVLNVSQRTPTTHAMSPRLRHVLLELLPRLLGSPPPPEAPRAPPVATMVSKGEELFT
GVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQ
CFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGID
FKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIG
DGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKAPRAASPPRRA
SSVGLLLRAEELILKKPRSELVFEGQRHRQGTWTAAFCQSLGAAAPEVRCCVDAVNFVAE
STRDQEATGEEVSDWVRMGNALDNICFWAALVLFSVGSSLIFLGAYFNRVPDLPYAPCIQ
P

Sequence of entity 5 (C, G), FASTA

>9GU2_5 Fab35 light chain (chains C, G)
DIVITQSPSLLSASVGDRVTLTCKGSQNIDNYLAWYQQKLGEAPKLLIYKTNSLQTGIPS
RFSGSGSGTDYTLTISSLHSEDLATYYCYQYINGYTFGTGTKLELKRADAAPTVSIFPPS
TEQLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSL
TKADYESHNLYTCEVVHKTSSSPVVKSFNRNEC

Sequence of entity 6 (F, H), FASTA

>9GU2_6 Fab35 heavy chain (chains F, H)
EVQLQESGPGLVQPSETLSLTCTVSGFSLTSYSVSWLRQPSGKGPEWMGRMWDDGGTVYN
SGLKSRLSISRDTSKNQVFLKMNSLQTDDTGTYYCTRDERIRAINWFAYWGQGTLVTVSS
AETTAPSVYPLAPGTALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSG
LYTLTSSVTVPSSTWPSQTVTCNVAHPGQQHQRWTRKLC

Ligands and cofactors

ID	Name	Formula	Copies
CU	Copper (II) ion	Cu	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1
ACH	Acetylcholine	C7 H16 N O2	2

Primary citation

Structures of the human adult muscle-type nicotinic receptor in resting and desensitized states. Li, A., Pike, A.C.W., Webster, R. et al. Cell Rep (2025) 44:115581-115581. DOI 10.1016/j.celrep.2025.115581 · PubMed

Other PDB entries of the same protein (UniProt P02708 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DMS 1.92 Å, Human muscle nAChR with fab6-bound
9DMG 2.05 Å, Human muscle nAChR apo state
9DMH 2.06 Å, Human muscle nAChR ACh-bound state
9DMQ 2.06 Å, Human muscle nAChR with fab3-bound
9DMV 2.13 Å, Human muscle nAChR with fab9-bound
9DMT 2.18 Å, Human muscle nAChR with fab7-bound
9DMJ 2.19 Å, Human muscle nAChR with two fab1b-bound
9YER 2.19 Å, Human muscle nAChR SCCMS eT264P ACh bound
9YE8 2.22 Å, Human muscle nAChR SCCMS eL269F ACh bound
4ZJS 2.23 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia Californica…
9DML 2.24 Å, Human muscle nAChR with fab2-bound
9YEI 2.36 Å, Human muscle nAChR SCCMS eL269F ACh, Reboxetine bound (lower 1)

Browse structure collections

About this viewer

MolViewer shows 9GU2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.