9GU3: Acetylcholine receptor subunit alpha
Human adult muscle nAChR in desensitised state in nanodisc with 1 mM acetylcholine. Determined by electron microscopy at 2.64 Å resolution. Released 14 May 2025.
- Method
- Electron microscopy
- Resolution
- 2.64 Å
- Organisms
- Homo sapiens, Aequorea victoria, Rattus norvegicus
- Chains
- 9
- Atoms
- 19,563
- Mol. weight
- 392.01 kDa
- Ligands
- NAG, ACH
- Released
- 14 May 2025
Explore 9GU3 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9GU3 contains 90 α-helices and 170 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 11 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| β-strand | 29-44 | 16 | 1 |
| β-strand | 49-61 | 13 | 1 |
| α-helix | 63-65 | 3 | |
| α-helix | 69-72 | 4 | |
| β-strand | 77-81 | 5 | 1 |
| β-strand | 90-92 | 3 | 2 |
| β-strand | 95 | 1 | 1 |
| β-strand | 107-111 | 5 | 1 |
| β-strand | 115-118 | 4 | 1 |
| β-strand | 121-127 | 7 | 1 |
| β-strand | 139-148 | 10 | 2 |
| β-strand | 156-160 | 5 | 1 |
| β-strand | 166 | 1 | 1 |
| β-strand | 171 | 1 | 1 |
| β-strand | 176-188 | 13 | 2 |
| β-strand | 198-209 | 12 | 2 |
| α-helix | 212-214 | 3 | |
| α-helix | 215-219 | 5 | |
| α-helix | 220-231 | 12 | |
| α-helix | 232-234 | 3 | |
| α-helix | 237-239 | 3 | |
| α-helix | 242-263 | 22 | |
| α-helix | 273-296 | 24 | |
| α-helix | 403-425 | 23 | |
Chain B: 16 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-12 | 11 | |
| α-helix | 27-28 | 2 | |
| β-strand | 29-44 | 16 | 3 |
| β-strand | 49-61 | 13 | 3 |
| α-helix | 63-65 | 3 | |
| α-helix | 69-72 | 4 | |
| β-strand | 77-80 | 4 | 3 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 4 |
| β-strand | 95 | 1 | 3 |
| α-helix | 106-107 | 2 | |
| β-strand | 108-111 | 4 | 3 |
| β-strand | 115-118 | 4 | 3 |
| β-strand | 121-127 | 7 | 3 |
| β-strand | 139-148 | 10 | 4 |
| β-strand | 156-160 | 5 | 3 |
| α-helix | 161-163 | 3 | |
| β-strand | 171 | 1 | 5 |
| β-strand | 173 | 1 | 3 |
| β-strand | 180 | 1 | 3 |
| β-strand | 185-189 | 5 | 4 |
| β-strand | 191 | 1 | 5 |
| β-strand | 192-195 | 4 | 4 |
| β-strand | 211-220 | 10 | 4 |
| α-helix | 223-225 | 3 | |
| α-helix | 226-230 | 5 | |
| α-helix | 231-242 | 12 | |
| α-helix | 243-245 | 3 | |
| α-helix | 248-250 | 3 | |
| α-helix | 253-274 | 22 | |
| α-helix | 284-308 | 25 | |
| α-helix | 438-469 | 32 | |
| α-helix | 471-473 | 3 | |
Chains C and G: 5 helices, 23 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-7 | 4 | 16 |
| β-strand | 10-13 | 4 | 17 |
| β-strand | 19-25 | 7 | 16 |
| β-strand | 33-38 | 6 | 17 |
| β-strand | 45-49 | 5 | 17 |
| β-strand | 53-54 | 2 | 17 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 16 |
| β-strand | 70-75 | 6 | 16 |
| α-helix | 80-82 | 3 | |
| β-strand | 85-90 | 6 | 17 |
| β-strand | 96-97 | 2 | 17 |
| β-strand | 101-105 | 5 | 17 |
| β-strand | 110 | 1 | 18 |
| β-strand | 113-117 | 5 | 19 |
| α-helix | 118-120 | 3 | |
| α-helix | 121-125 | 5 | |
| β-strand | 128 | 1 | 20 |
| β-strand | 131-138 | 8 | 19 |
| β-strand | 139 | 1 | 18 |
| β-strand | 143-149 | 7 | 21 |
| β-strand | 152-154 | 3 | 21 |
| β-strand | 158-162 | 5 | 19 |
| β-strand | 172-178 | 7 | 19 |
| β-strand | 181 | 1 | 20 |
| α-helix | 182-186 | 5 | |
| β-strand | 190-197 | 8 | 21 |
| β-strand | 204-209 | 6 | 21 |
Chain D: 16 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-8 | 6 | |
| α-helix | 9-14 | 6 | |
| α-helix | 29-30 | 2 | |
| β-strand | 31-46 | 16 | 6 |
| β-strand | 51-63 | 13 | 6 |
| α-helix | 65-67 | 3 | |
| α-helix | 71-74 | 4 | |
| β-strand | 79-82 | 4 | 6 |
| β-strand | 92-94 | 3 | 7 |
| β-strand | 97 | 1 | 6 |
| α-helix | 108-109 | 2 | |
| β-strand | 110-113 | 4 | 6 |
| β-strand | 117-120 | 4 | 6 |
| β-strand | 123-129 | 7 | 6 |
| β-strand | 141-150 | 10 | 7 |
| β-strand | 158-162 | 5 | 6 |
| α-helix | 163 | 1 | |
| β-strand | 164-167 | 4 | 8 |
| β-strand | 170-173 | 4 | 8 |
| β-strand | 176 | 1 | 9 |
| β-strand | 178 | 1 | 6 |
| β-strand | 185 | 1 | 6 |
| β-strand | 190-194 | 5 | 7 |
| β-strand | 196 | 1 | 9 |
| β-strand | 197-201 | 5 | 7 |
| β-strand | 213-223 | 11 | 7 |
| α-helix | 226-228 | 3 | |
| α-helix | 229-233 | 5 | |
| α-helix | 234-242 | 9 | |
| α-helix | 243-247 | 5 | |
| α-helix | 251-253 | 3 | |
| α-helix | 256-277 | 22 | |
| α-helix | 287-311 | 25 | |
| α-helix | 446-472 | 27 | |
| α-helix | 490-492 | 3 | |
Chain E: 15 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-12 | 10 | |
| α-helix | 27-28 | 2 | |
| β-strand | 29-44 | 16 | 10 |
| β-strand | 49-61 | 13 | 10 |
| α-helix | 63-65 | 3 | |
| α-helix | 69-71 | 3 | |
| β-strand | 77-80 | 4 | 10 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 11 |
| β-strand | 95 | 1 | 10 |
| α-helix | 106-107 | 2 | |
| β-strand | 108-111 | 4 | 10 |
| β-strand | 115-118 | 4 | 10 |
| β-strand | 121-127 | 7 | 10 |
| β-strand | 139-148 | 10 | 11 |
| β-strand | 156-160 | 5 | 10 |
| β-strand | 162 | 1 | 12 |
| β-strand | 168 | 1 | 12 |
| β-strand | 171 | 1 | 13 |
| β-strand | 173 | 1 | 10 |
| β-strand | 185-189 | 5 | 11 |
| β-strand | 191 | 1 | 13 |
| β-strand | 192-197 | 6 | 11 |
| β-strand | 207-218 | 12 | 11 |
| α-helix | 221-223 | 3 | |
| α-helix | 224-228 | 5 | |
| α-helix | 229-238 | 10 | |
| α-helix | 239-243 | 5 | |
| α-helix | 252-273 | 22 | |
| α-helix | 283-306 | 24 | |
| α-helix | 432-459 | 28 | |
| α-helix | 461-464 | 4 | |
| α-helix | 468-469 | 2 | |
Chain F: 4 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 22 |
| β-strand | 11-12 | 2 | 23 |
| β-strand | 18-25 | 8 | 22 |
| β-strand | 33-40 | 8 | 17 |
| β-strand | 46-51 | 6 | 17 |
| β-strand | 57-59 | 3 | 17 |
| β-strand | 67-72 | 6 | 22 |
| β-strand | 77-82 | 6 | 22 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-101 | 11 | 17 |
| β-strand | 104-110 | 7 | 17 |
| β-strand | 114-116 | 3 | 17 |
| β-strand | 117-118 | 2 | 23 |
| α-helix | 121-123 | 3 | |
| β-strand | 124 | 1 | 24 |
| α-helix | 125-126 | 2 | |
| β-strand | 127-131 | 5 | 25 |
| β-strand | 143-150 | 8 | 25 |
| β-strand | 153 | 1 | 24 |
| β-strand | 158-161 | 4 | 26 |
| α-helix | 163-166 | 4 | |
| β-strand | 170-178 | 9 | 25 |
| β-strand | 181-190 | 10 | 25 |
| β-strand | 201-206 | 6 | 26 |
| β-strand | 211-216 | 6 | 26 |
Chain H: 4 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 33 |
| β-strand | 11-12 | 2 | 34 |
| β-strand | 18-25 | 8 | 33 |
| β-strand | 33-40 | 8 | 28 |
| β-strand | 46-51 | 6 | 28 |
| β-strand | 57-59 | 3 | 28 |
| β-strand | 67-72 | 6 | 33 |
| β-strand | 77-82 | 6 | 33 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-101 | 11 | 28 |
| β-strand | 104-110 | 7 | 28 |
| β-strand | 114-116 | 3 | 28 |
| β-strand | 117-118 | 2 | 34 |
| α-helix | 121-123 | 3 | |
| β-strand | 124 | 1 | 35 |
| α-helix | 125-126 | 2 | |
| β-strand | 127-131 | 5 | 36 |
| β-strand | 143-152 | 10 | 36 |
| β-strand | 153 | 1 | 35 |
| β-strand | 158-161 | 4 | 37 |
| α-helix | 163-166 | 4 | |
| β-strand | 170-178 | 9 | 36 |
| β-strand | 181-190 | 10 | 36 |
| β-strand | 201-206 | 6 | 37 |
| β-strand | 211-216 | 6 | 37 |
Chain L: 14 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-11 | 9 | |
| β-strand | 29-44 | 16 | 14 |
| β-strand | 49-61 | 13 | 14 |
| α-helix | 63-65 | 3 | |
| α-helix | 69-72 | 4 | |
| β-strand | 77-81 | 5 | 14 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 15 |
| β-strand | 95 | 1 | 14 |
| α-helix | 106 | 1 | |
| β-strand | 107-111 | 5 | 14 |
| β-strand | 115-118 | 4 | 14 |
| β-strand | 121-127 | 7 | 14 |
| β-strand | 139-148 | 10 | 15 |
| β-strand | 156-160 | 5 | 14 |
| β-strand | 166 | 1 | 14 |
| α-helix | 170 | 1 | |
| β-strand | 171 | 1 | 14 |
| α-helix | 172-173 | 2 | |
| β-strand | 176-188 | 13 | 15 |
| β-strand | 198-209 | 12 | 15 |
| α-helix | 212-214 | 3 | |
| α-helix | 215-219 | 5 | |
| α-helix | 220-234 | 15 | |
| α-helix | 237-239 | 3 | |
| α-helix | 241-263 | 23 | |
| α-helix | 273-297 | 25 | |
| α-helix | 407-429 | 23 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Acetylcholine receptor subunit alpha | A, L | protein | 437 | Homo sapiens | P02708 (AlphaFold model) |
| Acetylcholine receptor subunit beta | B | protein | 478 | Homo sapiens | P11230 (AlphaFold model) |
| Acetylcholine receptor subunit delta | D | protein | 496 | Homo sapiens | Q07001 (AlphaFold model) |
| Acetylcholine receptor subunit epsilon,Green fluorescent protein | E | protein | 721 | Homo sapiens, Aequorea victoria | Q04844 (AlphaFold model) |
| Fab35 light chain | C, G | protein | 213 | Rattus norvegicus | |
| Fab35 heavy chain | F, H | protein | 219 | Rattus norvegicus | |
Sequence of entity 1 (A, L), FASTA
>9GU3_1 Acetylcholine receptor subunit alpha (chains A, L)
SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQQW
VDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTP
PAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKE
SRGWKHSVTYSCCPDTPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSG
EKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHH
RSPSTHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPM
GFHSPLIKHPEVKSAIEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCII
GTLAVFAGRLIELNQQG
Sequence of entity 2 (B), FASTA
>9GU3_2 Acetylcholine receptor subunit beta (chains B)
SEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLILAQLISLNEKDEEMSTKVYLDLEW
TDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNNDGNFDVALDISVVVSSDGSVRWQP
PGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVSLQTGLGPDGQGHQEIHIHEGTFI
ENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLIIRRKPLFYLVNVIAPCILITLLA
IFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPETSLSVPIIIKYLMFTMVLVTFSV
ILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRLKRPKPERDLMPEPPHCSSPGSGW
GRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFIDGPNRAVALLPELREVVSSISYI
ARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTSVGTLVIFLDATYHLPPPDPFP
Sequence of entity 3 (D), FASTA
>9GU3_3 Acetylcholine receptor subunit delta (chains D)
LNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTNVWIEH
GWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCNVLVYHYGFVYW
LPPAIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEITLSLKQDAKENRTYPVEWIIID
PEGFTENGEWEIVHRPARVNVDPRAPLDSPSRQDITFYLIIRRKPLFYIINILVPCVLIS
FMVNLVFYLPADSGEKTSVAISVLLAQSVFLLLISKRLPATSMAIPLIGKFLLFGMVLVT
MVVVICVIVLNIHFRTPSTHVLSEGVKKLFLETLPELLHMSRPAEDGPSPGALVRRSSSL
GYISKAEEYFLLKSRSDLMFEKQSERHGLARRLTTARRPPASSEQAQQELFNELKPAVDG
ANFIVNHMRDQNNYNEEKDSWNRVARTVDRLCLFVVTPVMVVGTAWIFLQGVYNQPPPQP
FPGDPYSYNVQDKRFI
Sequence of entity 4 (E), FASTA
>9GU3_4 Acetylcholine receptor subunit epsilon,Green fluorescent protein (chains E)
KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDW
QDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLVYEGGSVTWLP
PAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTFAVDNDGKTINKIDIDTEAYT
ENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRKPLFYVINIIVPCVLISGLVLL
AYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLSVPLLGRFLIFVMVVATLIVM
NCVIVLNVSQRTPTTHAMSPRLRHVLLELLPRLLGSPPPPEAPRAPPVATMVSKGEELFT
GVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQ
CFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGID
FKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIG
DGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKAPRAASPPRRA
SSVGLLLRAEELILKKPRSELVFEGQRHRQGTWTAAFCQSLGAAAPEVRCCVDAVNFVAE
STRDQEATGEEVSDWVRMGNALDNICFWAALVLFSVGSSLIFLGAYFNRVPDLPYAPCIQ
P
Sequence of entity 5 (C, G), FASTA
>9GU3_5 Fab35 light chain (chains C, G)
DIVITQSPSLLSASVGDRVTLTCKGSQNIDNYLAWYQQKLGEAPKLLIYKTNSLQTGIPS
RFSGSGSGTDYTLTISSLHSEDLATYYCYQYINGYTFGTGTKLELKRADAAPTVSIFPPS
TEQLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSL
TKADYESHNLYTCEVVHKTSSSPVVKSFNRNEC
Sequence of entity 6 (F, H), FASTA
>9GU3_6 Fab35 heavy chain (chains F, H)
EVQLQESGPGLVQPSETLSLTCTVSGFSLTSYSVSWLRQPSGKGPEWMGRMWDDGGTVYN
SGLKSRLSISRDTSKNQVFLKMNSLQTDDTGTYYCTRDERIRAINWFAYWGQGTLVTVSS
AETTAPSVYPLAPGTALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSG
LYTLTSSVTVPSSTWPSQTVTCNVAHPGQQHQRWTRKLC
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
| ACH | Acetylcholine | C7 H16 N O2 | 2 |
Primary citation
Structures of the human adult muscle-type nicotinic receptor in resting and desensitized states. Li, A., Pike, A.C.W., Webster, R. et al. Cell Rep (2025) 44:115581-115581. DOI 10.1016/j.celrep.2025.115581 · PubMed
Other PDB entries of the same protein (UniProt P02708 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9DMS 1.92 Å, Human muscle nAChR with fab6-bound
- 9DMG 2.05 Å, Human muscle nAChR apo state
- 9DMH 2.06 Å, Human muscle nAChR ACh-bound state
- 9DMQ 2.06 Å, Human muscle nAChR with fab3-bound
- 9DMV 2.13 Å, Human muscle nAChR with fab9-bound
- 9DMT 2.18 Å, Human muscle nAChR with fab7-bound
- 9DMJ 2.19 Å, Human muscle nAChR with two fab1b-bound
- 9YER 2.19 Å, Human muscle nAChR SCCMS eT264P ACh bound
- 9YE8 2.22 Å, Human muscle nAChR SCCMS eL269F ACh bound
- 4ZJS 2.23 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia Californica…
- 9DML 2.24 Å, Human muscle nAChR with fab2-bound
- 9YEI 2.36 Å, Human muscle nAChR SCCMS eL269F ACh, Reboxetine bound (lower 1)
Browse structure collections
About this viewer
MolViewer shows 9GU3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.