9GZ2: Myosin-7

Beta-cardiac heavy meromyosin motor domain in the primed state complexed to mavacamten. Determined by electron microscopy at 2.9 Å resolution. Released 12 Mar 2025.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 6,200
Mol. weight: 132.67 kDa
Ligands: XB2, PO4, ADP, MG
Released: 12 Mar 2025

Explore 9GZ2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9GZ2 contains 39 α-helices and 30 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 39 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	4-15	12
α-helix	20-26	7
β-strand	36-40	5	1
β-strand	46-55	10	1
β-strand	58-63	6	1
β-strand	68-72	5	1
β-strand	77-78	2	1
α-helix	79-81	3
α-helix	82-84	3
β-strand	89	1	2
α-helix	90-92	3
α-helix	98-109	12
β-strand	115-117	3	2
β-strand	122-125	4	2
α-helix	136-142	7
α-helix	151-152	2
α-helix	154-168	15
β-strand	172-177	6	2
β-strand	179	1	3
α-helix	184-201	18
α-helix	215-231	17
β-strand	232-233	2	4
β-strand	241-242	2	4
β-strand	246-252	7	2
β-strand	258-265	8	2
α-helix	270-273	4
β-strand	283	1	4
α-helix	284-291	8
α-helix	295-300	6
α-helix	307-309	3
α-helix	311-314	4
α-helix	325-338	14
α-helix	343-359	17
β-strand	363-366	4	5
β-strand	373-377	5	5
α-helix	379-387	9
α-helix	392-400	9
β-strand	403-406	4	6
β-strand	409-412	4	6
α-helix	414-416	3
α-helix	417-443	27
β-strand	448	1	2
β-strand	455-461	7	2
α-helix	462-464	3
β-strand	465	1	3
β-strand	471	1	7
α-helix	473-490	18
α-helix	491-495	5
α-helix	496-503	8
α-helix	518-525	8
α-helix	530-537	8
α-helix	545-556	12
β-strand	563-564	2	7
β-strand	577-581	5	7
β-strand	584-588	5	7
α-helix	593-598	6
α-helix	603-610	8
α-helix	615-620	6
α-helix	647-663	17
β-strand	666-673	8	2
α-helix	686-695	10
α-helix	698-707	10
β-strand	711-714	4	8
α-helix	715-722	8
α-helix	723-725	3
α-helix	738-748	11
β-strand	756-758	3	8
β-strand	762-765	4	8
α-helix	769-794	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-7	A	protein	1145	Homo sapiens	P12883 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9GZ2_1 Myosin-7 (chains A)
GDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTA
ETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIYTYSGLF
CVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESG
AGKTVNTKRVIQYFAVIAAIGDRSKKDQSPGKGTLEDQIIQANPALEAFGNAKTVRNDNS
SRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDML
LITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFGN
MKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVI
YATGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFT
NEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFP
KATDMTFKAKLFDNHLGKSANFQKPRNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDPL
NETVVGLYQKSSLKLLSTLFANYAGADAPIEKGKGKAKKGSSFQTVSALHRENLNKLMTN
LRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQR
YRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERL
SRIITRIQAQSRGVLARMEYKKLLERRDSLLVIQWNIRAFMGVKNWPWMKLYFKIKPLLK
SAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADA
EERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTL
AKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLT
KAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLK
KKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELESERTARAKVEKLRSDDYK
DDDDK

Ligands and cofactors

ID	Name	Formula	Copies
XB2	Mavacamten	C15 H19 N3 O2	1
PO4	Phosphate ion	O4 P	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
MG	Magnesium ion	Mg	1

Primary citation

Mavacamten inhibits myosin activity by stabilising the myosin interacting-heads motif and stalling motor force generation. McMillan, S.N., Pitts, J.R.T., Barua, B. et al. bioRxiv (2025). DOI 10.1101/2025.02.12.637875 · PubMed

Other PDB entries of the same protein (UniProt P12883 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CJ1 2.1 Å, Crystal structure of the coiled coil of MYH7 residues 1526 to 1571 fused to Gp7
6PF2 2.17 Å, Crystal Structure of Amino Acids 1220-1276 of Human Beta Cardiac Myosin Fused to Gp7 and…
6PFP 2.2 Å, Crystal Structure of Amino Acids 1473-1536 of Human Beta Cardiac Myosin Fused to Gp7 and…
4PA0 2.25 Å, Omecamtiv Mercarbil binding site on the Human Beta-Cardiac Myosin Motor Domain
5CHX 2.3 Å, Crystal Structure of amino acids 1590-1657 of MYH7
5CJ0 2.3 Å, Crystal Structure of Amino Acids 1631-1692 of MYH7
5WME 2.3 Å, Crystal Structure of Amino Acids 1729-1786 of Human Beta Cardiac Myosin Fused to Gp7 as…
4XA4 2.33 Å, Crystal Structure of the coiled-coil surrounding Skip 3 of MYH7
9HTF 2.48 Å, Beta-cardiac myosin Y115H mutant motor domain in the pre-powerstroke state, MgADP.VO4 form
2FXO 2.5 Å, Structure of the human beta-myosin S2 fragment
5WJ7 2.5 Å, Crystal Structure of Amino Acids 1733-1797 of Human Beta Cardiac Myosin Fused to Xrcc4
4XA3 2.55 Å, Crystal structure of the coiled-coil surrounding Skip 2 of MYH7

Browse structure collections

About this viewer

MolViewer shows 9GZ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.