9HG6: BAM-SurA complex in the swing-in state

BAM-SurA complex in the swing-in state. Determined by electron microscopy at 2.73 Å resolution. Released 16 Apr 2025.

Method: Electron microscopy
Resolution: 2.73 Å
Organism: Escherichia coli K-12
Chains: 6
Atoms: 16,225
Mol. weight: 246.67 kDa
Released: 16 Apr 2025

Explore 9HG6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HG6 contains 75 α-helices and 119 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 49 β-strands

Element	Residues	Length	Sheet
β-strand	28-32	5	1
α-helix	39-45	7
α-helix	56-68	13
β-strand	72-79	8	1
β-strand	83-90	8	1
α-helix	91-92	2
β-strand	93-100	8	2
α-helix	107-116	10
β-strand	124	1	2
α-helix	127-129	3
α-helix	130-143	14
β-strand	150-158	9	2
β-strand	162-170	9	2
α-helix	173-175	3
β-strand	176	1	3
β-strand	179-183	5	4
α-helix	190-195	6
β-strand	213	1	3
α-helix	216-231	16
β-strand	239-246	8	4
β-strand	255-261	7	4
β-strand	267-276	10	5
α-helix	281-285	5
α-helix	294	1
β-strand	295	1	5
α-helix	296	1
α-helix	298-313	16
β-strand	321-324	4	5
α-helix	326	1
β-strand	327-329	3	5
β-strand	334-342	9	5
α-helix	345-347	3
β-strand	348-355	8	6
α-helix	362-366	5
β-strand	376	1	6
α-helix	379-392	14
β-strand	395-404	10	6
α-helix	405	1
β-strand	411-420	10	6
β-strand	424-426	3	7
β-strand	440-446	7	7
α-helix	449-451	3
β-strand	455-462	8	7
β-strand	466-475	10	7
β-strand	484-494	11	7
β-strand	506-518	13	7
β-strand	523-537	15	7
α-helix	539-541	3
β-strand	542	1	8
α-helix	543-551	9
β-strand	564-579	16	7
β-strand	590-600	11	7
α-helix	601	1
β-strand	608-620	13	7
β-strand	628-640	13	7
α-helix	648-650	3
β-strand	652	1	9
β-strand	654	1	10
β-strand	663	1	11
β-strand	668	1	10
β-strand	671-673	3	12
β-strand	674	1	8
α-helix	675-676	2
β-strand	691	1	13
β-strand	696	1	13
β-strand	701-705	5	12
β-strand	708	1	9
β-strand	710-720	11	7
α-helix	727-729	3
β-strand	733-745	13	7
β-strand	767-778	12	7
β-strand	781-792	12	7
β-strand	799	1	11
β-strand	802-806	5	7

Chain B: 6 helices, 37 β-strands

Element	Residues	Length	Sheet
α-helix	35-37	3
β-strand	45-51	7	14
β-strand	66-68	3	15
β-strand	71-75	5	15
β-strand	80-85	6	15
β-strand	91-96	6	15
β-strand	111	1	16
α-helix	114-115	2
β-strand	116-118	3	17
β-strand	121-125	5	17
β-strand	126	1	16
β-strand	130-135	6	17
β-strand	141-146	6	17
β-strand	151	1	18
α-helix	154-155	2
β-strand	156-158	3	19
β-strand	161-165	5	19
β-strand	166	1	18
β-strand	170-175	6	19
β-strand	181-186	6	19
β-strand	192	1	4
α-helix	198-200	3
β-strand	201-203	3	20
β-strand	206-209	4	20
β-strand	215-220	6	20
β-strand	226-231	6	20
α-helix	241-243	3
β-strand	252-254	3	21
β-strand	257-261	5	21
β-strand	267-271	5	21
β-strand	277-279	3	21
β-strand	290-292	3	22
β-strand	295-299	5	22
β-strand	305-309	5	22
β-strand	315-319	5	22
β-strand	331-333	3	23
β-strand	336-339	4	23
β-strand	345-350	6	23
β-strand	356-361	6	23
α-helix	370-371	2
β-strand	372-374	3	14
β-strand	377-381	5	14
β-strand	386-391	6	14

Chain C: 15 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	29-32	4
α-helix	39-43	5
α-helix	44-47	4
α-helix	49-53	5
α-helix	58-61	4
α-helix	66-68	3
α-helix	77-79	3
α-helix	84-85	2
β-strand	97-100	4	24
β-strand	103-107	5	24
α-helix	116-126	11
β-strand	131-135	5	24
β-strand	140-147	8	24
β-strand	157-167	11	24
β-strand	172-183	12	24
β-strand	186-187	2	24
α-helix	191-223	33
β-strand	230-231	2	25
β-strand	234	1	26
β-strand	240	1	26
β-strand	243-244	2	25
α-helix	248-261	14
β-strand	266-269	4	27
β-strand	276-278	3	27
α-helix	285-290	6
β-strand	303-306	4	27
β-strand	310	1	28
β-strand	313	1	28
β-strand	317-319	3	27
α-helix	324	1
β-strand	325	1	27
α-helix	326-327	2
α-helix	328-335	8

Chain D: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	32-45	14
α-helix	48-61	14
α-helix	68-81	14
α-helix	85-98	14
α-helix	103-105	3
α-helix	106-119	14
α-helix	123-127	5
α-helix	132-134	3
α-helix	138-153	16
α-helix	160-188	29
α-helix	191-204	14
α-helix	209-224	16
α-helix	228-240	13

Chain E: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	34-35	2	29
α-helix	40-44	5
β-strand	51	1	30
α-helix	52-59	8
β-strand	65	1	29
β-strand	72-79	8	29
β-strand	87-95	9	29
β-strand	100	1	30
β-strand	101-107	7	29

Chain F: 14 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	23-27	5	1
β-strand	28-32	5	31
β-strand	35-38	4	31
α-helix	39-55	17
α-helix	57-59	3
α-helix	64-87	24
α-helix	93-96	4
α-helix	112-117	6
α-helix	125-148	24
α-helix	154-167	14
β-strand	173-182	10	32
α-helix	189-207	19
α-helix	212-219	8
α-helix	223-227	5
β-strand	230-234	5	32
α-helix	236-238	3
α-helix	241-246	6
α-helix	247-249	3
β-strand	255-261	7	32
β-strand	264-274	11	32
α-helix	394-420	27
β-strand	423-425	3	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer membrane protein assembly factor BamA	A	protein	790	Escherichia coli K-12	P0A940 (AlphaFold model)
Outer membrane protein assembly factor BamB	B	protein	381	Escherichia coli K-12	P77774 (AlphaFold model)
Outer membrane protein assembly factor BamC	C	protein	320	Escherichia coli K-12	P0A903 (AlphaFold model)
Outer membrane protein assembly factor BamD	D	protein	226	Escherichia coli K-12	P0AC02 (AlphaFold model)
Outer membrane protein assembly factor BamE	E	protein	102	Escherichia coli K-12	P0A937
Chaperone SurA	F	protein	412	Escherichia coli K-12	P0ABZ6

Sequence of entity 1 (A), FASTA

>9HG6_1 Outer membrane protein assembly factor BamA (chains A)
AEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRD
GDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDF
YYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLR
DEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNI
TEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYP
RVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSD
LVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSF
QAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDAD
LSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSD
QDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVP
IDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQAS
NYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWD
MGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAE
QFQFNIGKTW

Sequence of entity 2 (B), FASTA

>9HG6_2 Outer membrane protein assembly factor BamB (chains B)
CSLFNSEEDVVKMSPLPTVENQFTPTTAWSTSVGSGIGNFYSNLHPALADNVVYAADRAG
LVKALNADDGKEIWSVSLAEKDGWFSKEPALLSGGVTVSGGHVYIGSEKAQVYALNTSDG
TVAWQTKVAGEALSRPVVSDGLVLIHTSNGQLQALNEADGAVKWTVNLDMPSLSLRGESA
PTTAFGAAVVGGDNGRVSAVLMEQGQMIWQQRISQATGSTEIDRLSDVDTTPVVVNGVVF
ALAYNGNLTALDLRSGQIMWKRELGSVNDFIVDGNRIYLVDQNDRVMALTIDGGVTLWTQ
SDLLHRLLTSPVLYNGNLVVGDSEGYLHWINVEDGRFVAQQKVDSSGFQTEPVAADGKLL
IQAKDGTVYSITRWSHPQFEK

Sequence of entity 3 (C), FASTA

>9HG6_3 Outer membrane protein assembly factor BamC (chains C)
CSSDSRYKRQVSGDEAYLEAAPLAELHAPAGMILPVTSGDYAIPVTNGSGAVGKALDIRP
PAQPLALVSGARTQFTGDTASLLVENGRGNTLWPQVVSVLQAKNYTITQRDDAGQTLTTD
WVQWNRLDEDEQYRGRYQISVKPQGYQQAVTVKLLNLEQAGKPVADAASMQRYSTEMMNV
ISAGLDKSATDAANAAQNRASTTMDVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKVGM
KVTDSTRSQGNMAVTYKPLSDSDWQELGASDPGLASGDYKLQVGDLDNRSSLQFIDPKGH
TLTQSQNDALVAVFQAAFSK

Sequence of entity 4 (D), FASTA

>9HG6_4 Outer membrane protein assembly factor BamD (chains D)
CSGSKEEVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAY
YKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSALQGFFGVDRSDRDPQH
ARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVE
GMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSSNT

Sequence of entity 5 (E), FASTA

>9HG6_5 Outer membrane protein assembly factor BamE (chains E)
CSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQ
QPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGNKLHHHHHH

Sequence of entity 6 (F), FASTA

>9HG6_6 Chaperone SurA (chains F)
GSHMAPQVVDKVAAVVNNGVVLESDVDGLMQSVKLNAAQARQQLPDDATLRHQIMERLIM
DQIILQMGQKMGVKISDEQLDQAIANIAKQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEM
IISEVRNNEVRRRITILPQEVESLAQQVGNQNDASTELNLSHILIPLPENPTSDQVNEAE
SQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIV
GPIRSGVGFHILKVNDLRGESKNISVTEVHARHILLKPSPIMTDEQARVKLEQIAADIKS
GKTTFAAAAKEFSQDPGSANQGGDLGWATPDIFDPAFRDALTRLNKGQMSAPVHSSFGWH
LIELLDTRNVDKTDAAQKDRAYRMLMNRKFSEEAASWMQEQRASAYVKILSN

Primary citation

Architecture and conformational dynamics of the BAM-SurA holo insertase complex. Lehner, P.A., Degen, M., Jakob, R.P. et al. Sci Adv (2025) 11:eads6094-eads6094. DOI 10.1126/sciadv.ads6094 · PubMed

Other PDB entries of the same protein (UniProt P0A940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q6B 1.5 Å, The high-resolution and new form crystal structure of BamA POTRA4-5 from E.coli
9CS2 1.78 Å, E. coli BamA beta-barrel bound to cyclic peptide CP3
6QGW 1.94 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody E6
9CS0 1.94 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP1
9CS1 2.15 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP2
4XGA 2.15 Å, Crystal structure of BamB and BamA P3-5 complex from E.coli
2QDF 2.2 Å, Structure of N-terminal domain of E. Coli YaeT
6QGX 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody F7
7NRF 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 2)
7NRE 2.3 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 1)
7P1C 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin B
7R1V 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with dynobactin A

Browse structure collections

About this viewer

MolViewer shows 9HG6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.