9HG7: BAM-SurA complex in the swing-out state
BAM-SurA complex in the swing-out state. Determined by electron microscopy at 2.83 Å resolution. Released 16 Apr 2025.
- Method
- Electron microscopy
- Resolution
- 2.83 Å
- Organism
- Escherichia coli K-12
- Chains
- 6
- Atoms
- 15,236
- Mol. weight
- 246.67 kDa
- Released
- 16 Apr 2025
Explore 9HG7 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9HG7 contains 70 α-helices and 113 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 26 helices, 50 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 24 | 1 | 1 |
| β-strand | 28-32 | 5 | 2 |
| α-helix | 39-44 | 6 | |
| β-strand | 54 | 1 | 1 |
| α-helix | 56-68 | 13 | |
| β-strand | 72-80 | 9 | 2 |
| β-strand | 83-90 | 8 | 2 |
| α-helix | 91-92 | 2 | |
| β-strand | 93-100 | 8 | 3 |
| α-helix | 107-116 | 10 | |
| β-strand | 124 | 1 | 3 |
| α-helix | 127-129 | 3 | |
| α-helix | 130-144 | 15 | |
| β-strand | 150-157 | 8 | 3 |
| β-strand | 162-170 | 9 | 3 |
| α-helix | 171-175 | 5 | |
| β-strand | 176-183 | 8 | 4 |
| α-helix | 190-195 | 6 | |
| β-strand | 213 | 1 | 4 |
| α-helix | 216-232 | 17 | |
| β-strand | 239-247 | 9 | 4 |
| β-strand | 253-261 | 9 | 4 |
| β-strand | 267-276 | 10 | 5 |
| α-helix | 281-287 | 7 | |
| α-helix | 294 | 1 | |
| β-strand | 295 | 1 | 5 |
| α-helix | 296 | 1 | |
| α-helix | 298-314 | 17 | |
| β-strand | 321-329 | 9 | 5 |
| β-strand | 334-342 | 9 | 5 |
| α-helix | 345-347 | 3 | |
| β-strand | 348-355 | 8 | 6 |
| α-helix | 362-366 | 5 | |
| β-strand | 376 | 1 | 6 |
| α-helix | 380-392 | 13 | |
| β-strand | 395-404 | 10 | 6 |
| α-helix | 405 | 1 | |
| β-strand | 411-420 | 10 | 6 |
| β-strand | 425-429 | 5 | 7 |
| β-strand | 440-446 | 7 | 7 |
| α-helix | 449-451 | 3 | |
| β-strand | 455-462 | 8 | 7 |
| β-strand | 467-475 | 9 | 7 |
| β-strand | 484-493 | 10 | 7 |
| α-helix | 495-496 | 2 | |
| α-helix | 497-499 | 3 | |
| β-strand | 505-518 | 14 | 7 |
| β-strand | 523-537 | 15 | 7 |
| α-helix | 539-541 | 3 | |
| β-strand | 542 | 1 | 8 |
| α-helix | 543-551 | 9 | |
| β-strand | 560 | 1 | 9 |
| β-strand | 564-579 | 16 | 7 |
| β-strand | 590-600 | 11 | 7 |
| α-helix | 601 | 1 | |
| β-strand | 608-620 | 13 | 7 |
| β-strand | 628-640 | 13 | 7 |
| α-helix | 648-650 | 3 | |
| β-strand | 652 | 1 | 10 |
| β-strand | 654 | 1 | 11 |
| β-strand | 663 | 1 | 12 |
| β-strand | 668 | 1 | 11 |
| β-strand | 671-674 | 4 | 8 |
| β-strand | 677 | 1 | 13 |
| β-strand | 678 | 1 | 9 |
| β-strand | 692 | 1 | 13 |
| β-strand | 700-705 | 6 | 8 |
| β-strand | 708 | 1 | 10 |
| β-strand | 710-720 | 11 | 7 |
| α-helix | 727-732 | 6 | |
| β-strand | 733-745 | 13 | 7 |
| β-strand | 767-778 | 12 | 7 |
| β-strand | 781-792 | 12 | 7 |
| α-helix | 797-798 | 2 | |
| β-strand | 799 | 1 | 12 |
| β-strand | 802-806 | 5 | 7 |
Chain B: 7 helices, 40 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 33-37 | 5 | |
| β-strand | 45-51 | 7 | 14 |
| β-strand | 66-67 | 2 | 15 |
| β-strand | 71-74 | 4 | 15 |
| β-strand | 81-85 | 5 | 15 |
| β-strand | 91-95 | 5 | 15 |
| β-strand | 111 | 1 | 16 |
| β-strand | 116-118 | 3 | 16 |
| β-strand | 121-126 | 6 | 16 |
| β-strand | 130-135 | 6 | 16 |
| β-strand | 141-146 | 6 | 16 |
| α-helix | 154-155 | 2 | |
| β-strand | 156-158 | 3 | 17 |
| β-strand | 161-166 | 6 | 17 |
| β-strand | 170-175 | 6 | 17 |
| β-strand | 181-186 | 6 | 17 |
| β-strand | 193-194 | 2 | 4 |
| α-helix | 198-200 | 3 | |
| β-strand | 201 | 1 | 18 |
| β-strand | 206-209 | 4 | 18 |
| β-strand | 215-220 | 6 | 18 |
| β-strand | 226-231 | 6 | 18 |
| α-helix | 240-243 | 4 | |
| β-strand | 252-254 | 3 | 19 |
| β-strand | 257-261 | 5 | 19 |
| β-strand | 266 | 1 | 20 |
| β-strand | 267-271 | 5 | 19 |
| β-strand | 277-279 | 3 | 19 |
| β-strand | 282 | 1 | 20 |
| β-strand | 290-292 | 3 | 21 |
| β-strand | 295-299 | 5 | 21 |
| β-strand | 305-309 | 5 | 21 |
| β-strand | 317-318 | 2 | 21 |
| β-strand | 327 | 1 | 22 |
| α-helix | 328-330 | 3 | |
| β-strand | 331-333 | 3 | 23 |
| β-strand | 336-340 | 5 | 23 |
| β-strand | 341 | 1 | 22 |
| β-strand | 345-349 | 5 | 23 |
| β-strand | 356-361 | 6 | 23 |
| α-helix | 366 | 1 | |
| β-strand | 367 | 1 | 24 |
| α-helix | 370-371 | 2 | |
| β-strand | 372-374 | 3 | 14 |
| β-strand | 377-381 | 5 | 14 |
| β-strand | 382 | 1 | 24 |
| β-strand | 386-391 | 6 | 14 |
Chain C: 10 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 29-31 | 3 | |
| α-helix | 40-43 | 4 | |
| α-helix | 44-47 | 4 | |
| α-helix | 49-53 | 5 | |
| α-helix | 58-61 | 4 | |
| α-helix | 77-79 | 3 | |
| α-helix | 84-85 | 2 | |
| β-strand | 94-99 | 6 | 25 |
| β-strand | 103-108 | 6 | 25 |
| α-helix | 113-115 | 3 | |
| α-helix | 116-126 | 11 | |
| β-strand | 131-135 | 5 | 25 |
| β-strand | 140-143 | 4 | 25 |
| β-strand | 146-147 | 2 | 25 |
| β-strand | 158-168 | 11 | 25 |
| β-strand | 171-183 | 13 | 25 |
| β-strand | 186-188 | 3 | 25 |
| α-helix | 191-212 | 22 | |
Chain D: 12 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 32-45 | 14 | |
| α-helix | 48-61 | 14 | |
| α-helix | 70-81 | 12 | |
| α-helix | 85-98 | 14 | |
| α-helix | 105-118 | 14 | |
| α-helix | 123-127 | 5 | |
| α-helix | 132-134 | 3 | |
| α-helix | 138-153 | 16 | |
| α-helix | 160-188 | 29 | |
| α-helix | 191-204 | 14 | |
| α-helix | 209-224 | 16 | |
| α-helix | 228-242 | 15 | |
Chain E: 2 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 34-35 | 2 | 26 |
| α-helix | 40-45 | 6 | |
| β-strand | 51 | 1 | 27 |
| α-helix | 52-59 | 8 | |
| β-strand | 65 | 1 | 26 |
| β-strand | 72-79 | 8 | 26 |
| β-strand | 87-95 | 9 | 26 |
| β-strand | 100 | 1 | 27 |
| β-strand | 101-107 | 7 | 26 |
Chain F: 13 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 23-27 | 5 | 2 |
| β-strand | 28-32 | 5 | 28 |
| β-strand | 36-38 | 3 | 28 |
| α-helix | 39-56 | 18 | |
| α-helix | 63-87 | 25 | |
| α-helix | 93-102 | 10 | |
| α-helix | 114-116 | 3 | |
| α-helix | 121-123 | 3 | |
| α-helix | 125-149 | 25 | |
| α-helix | 154-163 | 10 | |
| β-strand | 173-182 | 10 | 29 |
| α-helix | 189-208 | 20 | |
| α-helix | 212-218 | 7 | |
| α-helix | 223-227 | 5 | |
| β-strand | 230-235 | 6 | 29 |
| α-helix | 236-238 | 3 | |
| α-helix | 244-247 | 4 | |
| β-strand | 255-260 | 6 | 29 |
| β-strand | 264-274 | 11 | 29 |
| α-helix | 393-420 | 28 | |
| β-strand | 423-425 | 3 | 28 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Outer membrane protein assembly factor BamA | A | protein | 790 | Escherichia coli K-12 | P0A940 (AlphaFold model) |
| Outer membrane protein assembly factor BamB | B | protein | 381 | Escherichia coli K-12 | P77774 (AlphaFold model) |
| Outer membrane protein assembly factor BamC | C | protein | 320 | Escherichia coli K-12 | P0A903 (AlphaFold model) |
| Outer membrane protein assembly factor BamD | D | protein | 226 | Escherichia coli K-12 | P0AC02 (AlphaFold model) |
| Outer membrane protein assembly factor BamE | E | protein | 102 | Escherichia coli K-12 | P0A937 |
| Chaperone SurA | F | protein | 412 | Escherichia coli K-12 | P0ABZ6 |
Sequence of entity 1 (A), FASTA
>9HG7_1 Outer membrane protein assembly factor BamA (chains A)
AEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRD
GDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDF
YYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLR
DEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNI
TEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYP
RVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSD
LVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSF
QAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDAD
LSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSD
QDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVP
IDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQAS
NYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWD
MGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAE
QFQFNIGKTW
Sequence of entity 2 (B), FASTA
>9HG7_2 Outer membrane protein assembly factor BamB (chains B)
CSLFNSEEDVVKMSPLPTVENQFTPTTAWSTSVGSGIGNFYSNLHPALADNVVYAADRAG
LVKALNADDGKEIWSVSLAEKDGWFSKEPALLSGGVTVSGGHVYIGSEKAQVYALNTSDG
TVAWQTKVAGEALSRPVVSDGLVLIHTSNGQLQALNEADGAVKWTVNLDMPSLSLRGESA
PTTAFGAAVVGGDNGRVSAVLMEQGQMIWQQRISQATGSTEIDRLSDVDTTPVVVNGVVF
ALAYNGNLTALDLRSGQIMWKRELGSVNDFIVDGNRIYLVDQNDRVMALTIDGGVTLWTQ
SDLLHRLLTSPVLYNGNLVVGDSEGYLHWINVEDGRFVAQQKVDSSGFQTEPVAADGKLL
IQAKDGTVYSITRWSHPQFEK
Sequence of entity 3 (C), FASTA
>9HG7_3 Outer membrane protein assembly factor BamC (chains C)
CSSDSRYKRQVSGDEAYLEAAPLAELHAPAGMILPVTSGDYAIPVTNGSGAVGKALDIRP
PAQPLALVSGARTQFTGDTASLLVENGRGNTLWPQVVSVLQAKNYTITQRDDAGQTLTTD
WVQWNRLDEDEQYRGRYQISVKPQGYQQAVTVKLLNLEQAGKPVADAASMQRYSTEMMNV
ISAGLDKSATDAANAAQNRASTTMDVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKVGM
KVTDSTRSQGNMAVTYKPLSDSDWQELGASDPGLASGDYKLQVGDLDNRSSLQFIDPKGH
TLTQSQNDALVAVFQAAFSK
Sequence of entity 4 (D), FASTA
>9HG7_4 Outer membrane protein assembly factor BamD (chains D)
CSGSKEEVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAY
YKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSALQGFFGVDRSDRDPQH
ARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVE
GMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSSNT
Sequence of entity 5 (E), FASTA
>9HG7_5 Outer membrane protein assembly factor BamE (chains E)
CSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQ
QPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGNKLHHHHHH
Sequence of entity 6 (F), FASTA
>9HG7_6 Chaperone SurA (chains F)
GSHMAPQVVDKVAAVVNNGVVLESDVDGLMQSVKLNAAQARQQLPDDATLRHQIMERLIM
DQIILQMGQKMGVKISDEQLDQAIANIAKQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEM
IISEVRNNEVRRRITILPQEVESLAQQVGNQNDASTELNLSHILIPLPENPTSDQVNEAE
SQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIV
GPIRSGVGFHILKVNDLRGESKNISVTEVHARHILLKPSPIMTDEQARVKLEQIAADIKS
GKTTFAAAAKEFSQDPGSANQGGDLGWATPDIFDPAFRDALTRLNKGQMSAPVHSSFGWH
LIELLDTRNVDKTDAAQKDRAYRMLMNRKFSEEAASWMQEQRASAYVKILSN
Primary citation
Architecture and conformational dynamics of the BAM-SurA holo insertase complex. Lehner, P.A., Degen, M., Jakob, R.P. et al. Sci Adv (2025) 11:eads6094-eads6094. DOI 10.1126/sciadv.ads6094 · PubMed
Other PDB entries of the same protein (UniProt P0A940 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3Q6B 1.5 Å, The high-resolution and new form crystal structure of BamA POTRA4-5 from E.coli
- 9CS2 1.78 Å, E. coli BamA beta-barrel bound to cyclic peptide CP3
- 6QGW 1.94 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody E6
- 9CS0 1.94 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP1
- 9CS1 2.15 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP2
- 4XGA 2.15 Å, Crystal structure of BamB and BamA P3-5 complex from E.coli
- 2QDF 2.2 Å, Structure of N-terminal domain of E. Coli YaeT
- 6QGX 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody F7
- 7NRF 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 2)
- 7NRE 2.3 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 1)
- 7P1C 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin B
- 7R1V 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with dynobactin A
Browse structure collections
About this viewer
MolViewer shows 9HG7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.