Structure of pcStar in the green fluorescent state. Determined by X-ray diffraction at 1.66 Å resolution. Released 16 Apr 2025.
Explore 9J0R in 3D Show helices and sheets RCSB PDB PDBe
9J0R contains 11 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-18 | 11 | 1 |
| β-strand | 21-32 | 12 | 1 |
| β-strand | 37-46 | 10 | 1 |
| α-helix | 48 | 1 | |
| α-helix | 50 | 1 | |
| α-helix | 54-60 | 7 | |
| β-strand | 70 | 1 | 1 |
| β-strand | 87-95 | 9 | 1 |
| β-strand | 100-110 | 11 | 1 |
| β-strand | 113-123 | 11 | 1 |
| β-strand | 136-139 | 4 | 1 |
| α-helix | 140-141 | 2 | |
| β-strand | 142-149 | 8 | 1 |
| β-strand | 152-163 | 12 | 1 |
| β-strand | 168-179 | 12 | 1 |
| α-helix | 184-189 | 6 | |
| β-strand | 190-201 | 12 | 1 |
| β-strand | 207-217 | 11 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-18 | 11 | 2 |
| β-strand | 21-32 | 12 | 2 |
| β-strand | 37-46 | 10 | 2 |
| α-helix | 48 | 1 | |
| α-helix | 50 | 1 | |
| α-helix | 54-60 | 7 | |
| β-strand | 70 | 1 | 2 |
| α-helix | 78-81 | 4 | |
| β-strand | 87-95 | 9 | 2 |
| β-strand | 100-110 | 11 | 2 |
| β-strand | 113-123 | 11 | 2 |
| β-strand | 136-139 | 4 | 2 |
| α-helix | 140-141 | 2 | |
| β-strand | 142-149 | 8 | 2 |
| β-strand | 152-163 | 12 | 2 |
| β-strand | 168-179 | 12 | 2 |
| α-helix | 184-188 | 5 | |
| β-strand | 190-201 | 12 | 2 |
| β-strand | 207-217 | 11 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Green to red photoconvertible GFP-like protein EosFP | A, B | protein | 228 | Lobophyllia hemprichii | Q5S6Z9 (AlphaFold model) |
>9J0R_1 Green to red photoconvertible GFP-like protein EosFP (chains A, B) GPEFMSAIKPDMKIKLRMEGNVNGHHFVIDGEGTGKPFEGKQSMDLEVKEGGPLPFAFDI LTTAFXNRVFAKYPDNIQDYFKQSFPKGYSWERSMTFEDGGICNARNDITMEGDTFYNKV RFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIEMALLLEGGAHYRCDFRTTYK AKEKGVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR
| ID | Name | Formula | Copies |
|---|---|---|---|
| DTT | 2,3-dihydroxy-1,4-dithiobutane | C4 H10 O2 S2 | 1 |
Structural basis for the fast maturation of pcStar, a photoconvertible fluorescent protein. Zheng, S., Shi, X., Lin, J. et al. Acta Crystallogr D Struct Biol (2025) 81:181-195. DOI 10.1107/S2059798325002141 · PubMed
Other PDB entries of the same protein (UniProt Q5S6Z9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9J0R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.