Human replication protein A: RPA70 subunit N-terminal domain. Determined by X-ray diffraction at 1.55 Å resolution. Released 9 Oct 2024.
Explore 9J1S in 3D Show helices and sheets RCSB PDB PDBe
9J1S contains 5 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-16 | 8 | |
| β-strand | 24-33 | 10 | 1 |
| β-strand | 41-47 | 7 | 1 |
| β-strand | 51-58 | 8 | 1 |
| α-helix | 60-62 | 3 | |
| α-helix | 63-67 | 5 | |
| β-strand | 76-86 | 11 | 1 |
| β-strand | 92-103 | 12 | 1 |
| α-helix | 115 | 1 | |
| β-strand | 116-117 | 2 | 1 |
| α-helix | 118 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Replication protein A 70 kDa DNA-binding subunit | A | protein | 120 | Homo sapiens | P27694 (AlphaFold model) |
>9J1S_1 Replication protein A 70 kDa DNA-binding subunit (chains A) MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLAT QLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Human replication protein A: RPA70 subunit N-terminal domain. Chakraborty, M., Ganguly, S.S., Das, A.K. et al. To be published.
Other PDB entries of the same protein (UniProt P27694 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9J1S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.