9JXV: PDB entry 9JXV

human translocase of the outer mitochondrial membrane (TOM complex). Determined by electron microscopy at 2.89 Å resolution. Released 15 Oct 2025.

Method: Electron microscopy
Resolution: 2.89 Å
Organism: Homo sapiens
Chains: 10
Atoms: 7,390
Mol. weight: 148.33 kDa
Ligands: PC1
Released: 15 Oct 2025

Explore 9JXV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9JXV contains 26 α-helices and 38 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	77-79	3
α-helix	83-85	3
α-helix	88-91	4
α-helix	95-96	2
β-strand	100-110	11	1
β-strand	113-121	9	1
β-strand	128-136	9	1
β-strand	149-155	7	1
β-strand	160-167	8	1
β-strand	172-181	10	1
β-strand	184-195	12	1
β-strand	199-206	8	1
β-strand	215-226	12	1
β-strand	229-240	12	1
β-strand	243-255	13	1
β-strand	259-266	8	1
β-strand	269-276	8	1
β-strand	282-291	10	1
β-strand	296-307	12	1
β-strand	312-319	8	1
β-strand	323-332	10	1
β-strand	337-346	10	1
β-strand	351-360	10	1

Chain B: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	77-79	3
α-helix	83-85	3
α-helix	88-91	4
α-helix	95-96	2
β-strand	100-110	11	2
β-strand	113-121	9	2
β-strand	128-136	9	2
β-strand	149-155	7	2
β-strand	160-167	8	2
β-strand	172-181	10	2
β-strand	184-195	12	2
β-strand	199-206	8	2
β-strand	215-226	12	2
β-strand	229-240	12	2
β-strand	243-255	13	2
β-strand	259-266	8	2
β-strand	269-277	9	2
β-strand	282-291	10	2
β-strand	296-307	12	2
β-strand	312-319	8	2
β-strand	323-329	7	2
β-strand	340-346	7	2
β-strand	351-360	10	2

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	67-70	4
α-helix	71-95	25
α-helix	97-108	12

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	67-95	29
α-helix	97-108	12

Chain E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	25-36	12
α-helix	41-60	20

Chain F: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	25-35	11
α-helix	41-60	20

Chain G: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	6-38	33
α-helix	40-41	2
α-helix	45-47	3
α-helix	50-52	3

Chain H: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	6-37	32
α-helix	45-47	3
α-helix	49-52	4

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitochondrial import receptor subunit TOM40 homolog	A, B	protein	361	Homo sapiens	O96008 (AlphaFold model)
Mitochondrial import receptor subunit TOM22 homolog	C, D	protein	142	Homo sapiens	Q9NS69 (AlphaFold model)
Mitochondrial import receptor subunit TOM6 homolog	E, F	protein	74	Homo sapiens	Q96B49 (AlphaFold model)
Mitochondrial import receptor subunit TOM7 homolog	G, H	protein	55	Homo sapiens	Q9P0U1 (AlphaFold model)
Mitochondrial import receptor subunit TOM5 homolog	I, J	protein	51	Homo sapiens	Q8N4H5

Sequence of entity 1 (A, B), FASTA

>9JXV_1 Mitochondrial import receptor subunit TOM40 homolog (chains A, B)
MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGA
ATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVA
LSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQT
QQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRR
PGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVS
FGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTI
G

Sequence of entity 2 (C, D), FASTA

>9JXV_2 Mitochondrial import receptor subunit TOM22 homolog (chains C, D)
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVR
SAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQIL
LGPNTGLSGGMPGALPSLPGKI

Sequence of entity 3 (E, F), FASTA

>9JXV_3 Mitochondrial import receptor subunit TOM6 homolog (chains E, F)
MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLAR
NLSDIDLMAPQPGV

Sequence of entity 4 (G, H), FASTA

>9JXV_4 Mitochondrial import receptor subunit TOM7 homolog (chains G, H)
MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG

Sequence of entity 5 (I, J), FASTA

>9JXV_5 Mitochondrial import receptor subunit TOM5 homolog (chains I, J)
MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI

Ligands and cofactors

ID	Name	Formula	Copies
PC1	1,2-diacyl-sn-glycero-3-phosphocholine	C44 H88 N O8 P	1

Primary citation

human translocase of the outer mitochondrial membrane (TOM complex). Wang, W.H., Yang, M.J. To be published.

Other PDB entries of the same protein (UniProt O96008 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7VD2 2.53 Å, Human TOM complex without cross-linking
7VBY 2.54 Å, Tom core complex with Tom20 and Tom22 subunits.
9EII 2.75 Å, Import stalled PINK1 TOM complex, symmetry expanded
8XDN 2.93 Å, TOM complex with small molecule
9WV3 2.98 Å, Human TOM complex with substrate Tim22-GGC1-sfGFP
7CP9 3.0 Å, Cryo-EM structure of human mitochondrial translocase TOM complex at 3.0 angstrom.
9EIH 3.1 Å, Import stalled PINK1 TOM complex
9WV2 3.15 Å, Human TOM complex with substrate GGC1-sfGFP
9EIJ 3.3 Å, Import stalled PINK1 TOM complex, extended TOM20 helix class
7CK6 3.4 Å, Protein translocase of mitochondria
7VC4 3.74 Å, Tom complex with Tom22 and Tom20 subunits
7VDD 3.74 Å, Human TOM complex with cross-linking

Browse structure collections

About this viewer

MolViewer shows 9JXV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.