9KZT: 3:3 LGI1-ADAM22 complex

Cryo-EM structure of the 3:3 LGI1-ADAM22 complex. Determined by electron microscopy at 3.79 Å resolution. Released 25 Jun 2025.

Method: Electron microscopy
Resolution: 3.79 Å
Organism: Homo sapiens
Chains: 6
Atoms: 23,526
Mol. weight: 352.12 kDa
Released: 25 Jun 2025

Explore 9KZT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9KZT contains 63 α-helices and 222 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	240-247	8	1
α-helix	249-254	6
α-helix	259-281	23
β-strand	284-292	9	1
α-helix	305-318	14
β-strand	326-331	6	1
β-strand	342-343	2	1
β-strand	356-359	4	1
α-helix	367-377	11
α-helix	384-389	6
α-helix	416-427	12
α-helix	432-434	3
α-helix	463-466	4
β-strand	474	1	2
β-strand	479	1	2
β-strand	491-492	2	3
β-strand	495-496	2	3
α-helix	497-498	2
β-strand	502-504	3	4
β-strand	511-512	2	5
β-strand	514-515	2	4
α-helix	523-526	4
β-strand	527-528	2	5
β-strand	534	1	6
β-strand	541-543	3	6
β-strand	546-548	3	6
α-helix	550-557	8
β-strand	563-564	2	7
α-helix	565-566	2
α-helix	567-574	8
β-strand	602	1	8
β-strand	605-606	2	7
β-strand	617	1	9
β-strand	622-624	3	10
β-strand	635-637	3	10
β-strand	640	1	9
β-strand	650	1	8
α-helix	651-652	2
β-strand	656	1	11
β-strand	661-663	3	11
β-strand	668-670	3	11
α-helix	671-674	4
β-strand	693-694	2	12
β-strand	700-701	2	12
α-helix	702	1
β-strand	706	1	13
β-strand	714	1	13

Chain B: 3 helices, 45 β-strands

Element	Residues	Length	Sheet
β-strand	53-55	3	14
β-strand	72-75	4	14
β-strand	81-82	2	15
β-strand	95-99	5	14
β-strand	105-106	2	15
β-strand	119-123	5	14
α-helix	132-134	3
β-strand	138	1	16
β-strand	143-147	5	14
β-strand	162	1	16
β-strand	167	1	14
α-helix	179-190	12
β-strand	199-201	3	17
β-strand	207-210	4	17
α-helix	217-219	3
β-strand	227-230	4	18
β-strand	236	1	19
β-strand	241-244	4	20
β-strand	247-250	4	20
β-strand	253-254	2	20
β-strand	259-266	8	20
β-strand	271-278	8	20
β-strand	283-291	9	21
β-strand	294-301	8	21
β-strand	307-312	6	21
β-strand	317-323	7	21
β-strand	334-340	7	22
β-strand	343-349	7	22
β-strand	360-362	3	22
β-strand	367-369	3	22
β-strand	381-383	3	23
β-strand	386-388	3	24
β-strand	395-397	3	24
β-strand	398-402	5	23
β-strand	409-413	5	23
β-strand	420-421	2	23
β-strand	436-438	3	25
β-strand	445-447	3	25
β-strand	452-460	9	25
β-strand	465-474	10	25
β-strand	479-484	6	26
β-strand	487-492	6	26
β-strand	499-505	7	26
β-strand	510-517	8	26
β-strand	527-530	4	18
β-strand	533-536	4	18
β-strand	540	1	19
β-strand	547-549	3	18

Chain C: 16 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	239-247	9	27
α-helix	249-254	6
α-helix	259-279	21
β-strand	283-292	10	27
α-helix	305-318	14
β-strand	326-331	6	27
β-strand	341-343	3	27
β-strand	355-359	5	27
α-helix	363-377	15
α-helix	384-389	6
α-helix	416-428	13
α-helix	432-434	3
β-strand	435	1	27
α-helix	463-466	4
β-strand	474-475	2	28
β-strand	478-479	2	28
β-strand	491-492	2	29
β-strand	495-496	2	29
α-helix	497-498	2
β-strand	502-504	3	30
β-strand	511	1	31
β-strand	514-515	2	30
α-helix	523-526	4
β-strand	528	1	31
β-strand	533	1	32
β-strand	541-543	3	32
β-strand	546-548	3	32
α-helix	550-557	8
β-strand	563-564	2	33
α-helix	567-573	7
α-helix	590-592	3
β-strand	602	1	34
β-strand	604-606	3	33
β-strand	622-624	3	33
β-strand	635-637	3	33
β-strand	650	1	34
α-helix	651-652	2
β-strand	656-658	3	35
β-strand	661-663	3	35
β-strand	668-669	2	35
α-helix	671-674	4
α-helix	676-678	3
β-strand	693-694	2	36
β-strand	700-701	2	36

Chain D: 7 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	46-48	3	37
β-strand	52-56	5	37
β-strand	71-75	5	37
α-helix	82-83	2
β-strand	87	1	38
β-strand	95-96	2	37
β-strand	99	1	37
β-strand	105-106	2	39
α-helix	107	1
β-strand	111	1	38
β-strand	119-120	2	37
β-strand	129-130	2	39
β-strand	143-145	3	37
α-helix	159-161	3
β-strand	167-169	3	37
α-helix	182-188	7
β-strand	194-196	3	37
α-helix	211-213	3
β-strand	226-228	3	40
β-strand	239-242	4	41
β-strand	249-254	6	41
β-strand	259-266	8	41
β-strand	271-279	9	41
β-strand	283-287	5	42
β-strand	290-291	2	42
β-strand	294-301	8	42
β-strand	306-311	6	42
β-strand	318-322	5	42
β-strand	332-340	9	43
β-strand	343-350	8	43
β-strand	358-361	4	43
β-strand	381-387	7	44
β-strand	396-403	8	44
β-strand	406-414	9	44
β-strand	419-421	3	44
β-strand	434-440	7	45
β-strand	443-449	7	45
α-helix	454	1
β-strand	455-460	6	45
β-strand	465-471	7	45
β-strand	479-484	6	46
β-strand	487-492	6	46
β-strand	499-504	6	46
β-strand	511-517	7	46
β-strand	525-530	6	40
β-strand	533-538	6	40
α-helix	544-545	2
β-strand	546-550	5	40

Chain E: 16 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	239-247	9	47
α-helix	249-254	6
α-helix	259-277	19
β-strand	283-292	10	47
α-helix	300-302	3
α-helix	305-319	15
β-strand	326-330	5	47
β-strand	341-343	3	47
β-strand	355-358	4	47
α-helix	363-377	15
α-helix	384-389	6
α-helix	416-428	13
α-helix	444-446	3
α-helix	463-466	4
β-strand	475	1	48
β-strand	478	1	48
β-strand	491-492	2	49
β-strand	495-496	2	49
α-helix	497-498	2
β-strand	502-504	3	50
β-strand	511	1	51
β-strand	514-515	2	50
α-helix	523-526	4
β-strand	528	1	51
α-helix	529-530	2
β-strand	541-543	3	52
β-strand	546-548	3	52
α-helix	550-557	8
β-strand	563-564	2	53
α-helix	567-573	7
β-strand	602	1	54
β-strand	605-606	2	53
β-strand	617	1	55
β-strand	622-624	3	53
β-strand	635-637	3	53
β-strand	640	1	55
β-strand	650	1	54
α-helix	651-652	2
β-strand	658	1	56
β-strand	661-663	3	56
β-strand	668-670	3	56
α-helix	672-674	3
β-strand	693-694	2	57
β-strand	700-701	2	57
β-strand	706	1	58
β-strand	714	1	58

Chain F: 5 helices, 47 β-strands

Element	Residues	Length	Sheet
β-strand	49	1	59
β-strand	52	1	59
β-strand	53-56	4	60
β-strand	71-75	5	60
α-helix	87-89	3
β-strand	95-99	5	60
β-strand	105	1	61
β-strand	111	1	62
β-strand	119-123	5	60
β-strand	129	1	61
β-strand	135	1	62
β-strand	143-145	3	60
β-strand	167	1	60
α-helix	179-181	3
α-helix	182-190	9
β-strand	194	1	60
α-helix	198	1
β-strand	199-201	3	63
β-strand	207-210	4	63
α-helix	216-218	3
β-strand	226-232	7	64
β-strand	239-244	6	65
β-strand	247-254	8	65
β-strand	259-265	7	65
β-strand	272-279	8	65
β-strand	283-291	9	66
β-strand	294-301	8	66
β-strand	307-312	6	66
β-strand	317-323	7	66
β-strand	332-340	9	67
β-strand	343-350	8	67
β-strand	357-362	6	67
β-strand	367-373	7	67
β-strand	379-387	9	68
β-strand	396-403	8	68
β-strand	406-412	7	68
β-strand	413-414	2	69
β-strand	419-420	2	69
β-strand	424	1	68
β-strand	434	1	70
β-strand	437-440	4	71
β-strand	443-448	6	71
β-strand	449	1	70
β-strand	454-460	7	71
β-strand	465-472	8	71
β-strand	480-484	5	72
β-strand	487-492	6	72
β-strand	499-505	7	72
β-strand	510-517	8	72
β-strand	522-530	9	64
β-strand	533-540	8	64
β-strand	545-550	6	64

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disintegrin and metalloproteinase domain-containing protein 22	A, C, E	protein	497	Homo sapiens	Q9P0K1 (AlphaFold model)
Leucine-rich glioma-inactivated protein 1	B, D, F	protein	544	Homo sapiens	O95970 (AlphaFold model)

Sequence of entity 1 (A, C, E), FASTA

>9KZT_1 Disintegrin and metalloproteinase domain-containing protein 22 (chains A, C, E)
NVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMET
WATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLL
KGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPK
KFTQCNIEEYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAE
CCKKCTLTQDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDG
YSCDGVQGICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQ
CNKRDVLCGYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVE
DGTPCGPQMMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCN
TYFPHNDDAKTGITLSG

Sequence of entity 2 (B, D, F), FASTA

>9KZT_2 Leucine-rich glioma-inactivated protein 1 (chains B, D, F)
DAAQPARRARRTYEAYPAKPKCPAVCTCTKDNALCENARSIPRTVPPDVISLSFVRSGFT
EISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKS
LIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYC
EGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKC
IFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIK
IQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDT
DVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLFTNQTDIPNMEDVYAVKHFSV
KGDVYICLTRFIGDSKVMKWGGSSFQDIQAMPSRGSMVFQPLQINNYQYAILGSDYSFTQ
VYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSAKHH
HHHH

Primary citation

Structural insights into heterohexameric assembly of epilepsy-related ligand-receptor complex LGI1-ADAM22. Yamaguchi, T., Okatsu, K., Kubota, M. et al. Elife (2025) 14. DOI 10.7554/eLife.105918 · PubMed

Other PDB entries of the same protein (UniProt Q9P0K1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CQF 1.8 Å, Crystal structure of PSD-95 PDZ3 fused with ADAM22 C-terminal peptide
3G5C 2.36 Å, Structural and biochemical studies on the ectodomain of human ADAM22
5Y2Z 2.67 Å, Crystal structure of human LGI1 EPTP-ADAM22 complex
9KZC 2.78 Å, Cryo-EM structure of the LGI1 LRR-LGI1 EPTP-ADAM22 ECD complex
8HQ2 2.93 Å, Crystal structure of human ADAM22 in complex with human LGI1 mutant
8Y6B 3.49 Å, Structure of human LGI1-ADAM22 complex in space group P212121
8HQ1 4.17 Å, Crystal Structure Of Human Lgi1-Adam22 Complex In Space Group C2
8HPY 5.87 Å, Crystal structure of human LGI1-ADAM22 complex
5Y31 7.13 Å, Crystal structure of human LGI1-ADAM22 complex

Browse structure collections

About this viewer

MolViewer shows 9KZT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.