9LXR: Beta-arrestin-1

A Cryo-EM structure of LA-PTH-PTH1R-Beta-arrestin1 complex (state 1 conformation). Determined by electron microscopy at 3.07 Å resolution. Released 10 Sept 2025.

Method: Electron microscopy
Resolution: 3.07 Å
Organisms: Homo sapiens, synthetic construct
Chains: 5
Atoms: 8,572
Mol. weight: 149.77 kDa
Released: 10 Sept 2025

Explore 9LXR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LXR contains 41 α-helices and 68 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 17 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
α-helix	14-16	3
β-strand	19-22	4	1
β-strand	26-28	3	2
β-strand	29-30	2	3
β-strand	33-34	2	3
α-helix	35-36	2
β-strand	37-42	6	1
α-helix	45-48	4
β-strand	52-62	11	4
α-helix	69-71	3
β-strand	76-85	10	4
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-117	6	1
α-helix	119-120	2
α-helix	123-125	3
β-strand	127-129	3	4
α-helix	130-131	2
β-strand	140-151	12	4
β-strand	164-168	5	4
β-strand	169-171	3	2
α-helix	181-182	2
β-strand	183-187	5	5
β-strand	198-203	6	5
β-strand	207-208	2	6
α-helix	212-213	2
β-strand	214-219	6	5
β-strand	228	1	7
β-strand	231-243	13	8
β-strand	245-258	14	8
β-strand	262	1	7
β-strand	269-274	6	5
α-helix	279-281	3
β-strand	288-290	3	4
α-helix	291-292	2
α-helix	299	1
β-strand	300	1	4
α-helix	301-303	3
β-strand	316-327	12	8
β-strand	343-349	7	8
β-strand	350-351	2	6
α-helix	353-355	3
α-helix	365-366	2
β-strand	367	1	9

Chain C: 4 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	10
β-strand	13-15	3	11
β-strand	21-28	8	10
β-strand	35-42	8	12
β-strand	48-55	8	12
β-strand	60-63	4	12
β-strand	71-76	6	10
β-strand	81-86	6	10
α-helix	91-93	3
β-strand	95-97	3	11
β-strand	98-103	6	12
β-strand	112-113	2	12
α-helix	114-116	3
β-strand	117-121	5	11
β-strand	130-133	4	13
β-strand	146-155	10	13
β-strand	161-164	4	14
β-strand	173-175	3	13
α-helix	176-178	3
β-strand	179-180	2	13
β-strand	186-194	9	13
α-helix	196-198	3
β-strand	206-210	5	14
β-strand	215-218	4	14

Chain E: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	15
β-strand	11-14	4	16
β-strand	19-26	8	15
β-strand	34-39	6	16
β-strand	46-50	5	16
β-strand	54-55	2	16
α-helix	56	1
β-strand	64-68	5	15
β-strand	71-78	8	15
α-helix	81-83	3
β-strand	86-91	6	16
β-strand	94	1	9
β-strand	98-99	2	16
β-strand	103-107	5	16
β-strand	117-119	3	17
α-helix	120-122	3
α-helix	123-127	5
β-strand	130-140	11	17
β-strand	147-151	5	18
β-strand	160-165	6	17
β-strand	174-183	10	17
α-helix	184-189	6
β-strand	192-197	6	18
β-strand	206-211	6	18

Chain L: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-32	30

Chain R: 14 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	34-43	10
α-helix	174-177	4
α-helix	180-211	32
α-helix	213-215	3
α-helix	218-245	28
α-helix	276-311	36
α-helix	318-346	29
α-helix	360-388	29
α-helix	402-417	16
α-helix	419-422	4
α-helix	427-429	3
α-helix	435-456	22
α-helix	457-461	5
α-helix	465-472	8
β-strand	504-506	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	B	protein	374	Homo sapiens	P49407 (AlphaFold model)
Fab30H	C	protein	230	synthetic construct
Fab30L	E	protein	215	synthetic construct
La-pth	L	protein	36	synthetic construct	F5GZD9 (AlphaFold model)
Parathyroid hormone/parathyroid hormone-related peptide receptor	R	protein	482	Homo sapiens	Q03431 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>9LXR_1 Beta-arrestin-1 (chains B)
MKGTRVFKKASCNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFR
YGREDLDVLGLTFRKDLFCANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPN
LPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQP
TAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADIC
LFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLCNNREKRGLALDGKLKHEDTNLAS
STLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPH
REVPENETPVDTNL

Sequence of entity 2 (C), FASTA

>9LXR_2 Fab30H (chains C)
MEISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYC
YTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV
LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT

Sequence of entity 3 (E), FASTA

>9LXR_3 Fab30L (chains E)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (L), FASTA

>9LXR_4 LA-PTH (chains L)
AVAEIQLMHQRAKWIQDARRRAFLHKLIAEIHTAEI

Sequence of entity 5 (R), FASTA

>9LXR_5 Parathyroid hormone/parathyroid hormone-related peptide receptor (chains R)
DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGK
LYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYR
RCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAV
LILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQ
APPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTV
FGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKKWIIQVPILASIVLNFILFINIVRVLA
TKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEML
FNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSSSYSYGPMVSHTSVT
NG

Primary citation

Structural basis of PTH1R-beta-arrestin core engagement reveals design principles for G-protein-biased therapeutics. Zhao, L.H., He, Q., Yuan, Q. et al. Nat Struct Mol Biol (2026) 33:868-881. DOI 10.1038/s41594-026-01806-7 · PubMed

Other PDB entries of the same protein (UniProt P49407 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AS4 2.3 Å, Crystal structure of human beta-arrestin-1
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
8ZYU 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
2IV8 2.8 Å, beta appendage in complex with b-arrestin peptide
8ZYY 2.83 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
9UYN 2.9 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to beta-arrestin 1 in…
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9LY2 3.1 Å, A Cryo-EM structure of LA-PTH-PTH1R-V2RT-Beta-arrestin1 complex (state 1 conformation)
9MBA 3.14 Å, Cryo-EM structure of complex of transducer-bound GPCR
25GN 3.2 Å, receptor-arrestin
8AS2 3.2 Å, Structure of arrestin2 in complex with 4P CCR5 phosphopeptide and Fab30

Browse structure collections

About this viewer

MolViewer shows 9LXR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.