9MGF: Outer membrane protein assembly factor BamA
beta-barrel assembly machine from Escherichia coli in a middle state of substrate assembly. Determined by electron microscopy at 3.3 Å resolution. Released 17 Dec 2025.
- Method
- Electron microscopy
- Resolution
- 3.3 Å
- Organism
- Escherichia coli K-12
- Chains
- 7
- Atoms
- 12,080
- Mol. weight
- 263.82 kDa
- Released
- 17 Dec 2025
Explore 9MGF in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9MGF contains 50 α-helices and 101 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 24 helices, 48 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 25 | 1 | 1 |
| β-strand | 28-30 | 3 | 2 |
| α-helix | 39-45 | 7 | |
| β-strand | 53 | 1 | 1 |
| α-helix | 56-69 | 14 | |
| β-strand | 75-78 | 4 | 2 |
| β-strand | 83-88 | 6 | 2 |
| β-strand | 94-99 | 6 | 3 |
| α-helix | 107-117 | 11 | |
| β-strand | 123 | 1 | 3 |
| α-helix | 127-143 | 17 | |
| β-strand | 150-158 | 9 | 3 |
| β-strand | 162-170 | 9 | 3 |
| α-helix | 174-175 | 2 | |
| β-strand | 176-183 | 8 | 4 |
| α-helix | 190-196 | 7 | |
| α-helix | 205-207 | 3 | |
| β-strand | 213 | 1 | 4 |
| α-helix | 216-233 | 18 | |
| β-strand | 239-247 | 9 | 4 |
| β-strand | 253-261 | 9 | 4 |
| β-strand | 267-268 | 2 | 5 |
| β-strand | 272-274 | 3 | 5 |
| α-helix | 281-285 | 5 | |
| β-strand | 294-295 | 2 | 5 |
| α-helix | 296 | 1 | |
| α-helix | 298-314 | 17 | |
| β-strand | 321-329 | 9 | 5 |
| β-strand | 334-342 | 9 | 5 |
| β-strand | 348-355 | 8 | 6 |
| α-helix | 362-366 | 5 | |
| β-strand | 375-376 | 2 | 6 |
| α-helix | 379-392 | 14 | |
| β-strand | 395-404 | 10 | 6 |
| α-helix | 405 | 1 | |
| β-strand | 411-420 | 10 | 6 |
| β-strand | 425-434 | 10 | 7 |
| β-strand | 439-449 | 11 | 7 |
| β-strand | 454-462 | 9 | 7 |
| β-strand | 466-479 | 14 | 7 |
| β-strand | 483-494 | 12 | 7 |
| β-strand | 505-518 | 14 | 7 |
| β-strand | 523-537 | 15 | 7 |
| α-helix | 539-541 | 3 | |
| β-strand | 542 | 1 | 8 |
| α-helix | 543-552 | 10 | |
| β-strand | 564-580 | 17 | 7 |
| β-strand | 590-600 | 11 | 7 |
| α-helix | 601 | 1 | |
| β-strand | 608-620 | 13 | 7 |
| β-strand | 628-640 | 13 | 7 |
| α-helix | 648-650 | 3 | |
| β-strand | 652 | 1 | 9 |
| β-strand | 656 | 1 | 10 |
| β-strand | 660 | 1 | 10 |
| β-strand | 663 | 1 | 11 |
| α-helix | 670 | 1 | |
| β-strand | 671 | 1 | 12 |
| α-helix | 672 | 1 | |
| β-strand | 674 | 1 | 8 |
| α-helix | 675-676 | 2 | |
| α-helix | 680-682 | 3 | |
| α-helix | 704 | 1 | |
| β-strand | 705 | 1 | 12 |
| α-helix | 706-707 | 2 | |
| β-strand | 708 | 1 | 9 |
| β-strand | 710-719 | 10 | 7 |
| β-strand | 733-745 | 13 | 7 |
| β-strand | 767-778 | 12 | 7 |
| β-strand | 781-792 | 12 | 7 |
| β-strand | 799 | 1 | 11 |
| β-strand | 802-806 | 5 | 7 |
Chain B: 5 helices, 37 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 32-34 | 3 | |
| β-strand | 45-51 | 7 | 13 |
| β-strand | 66-68 | 3 | 14 |
| β-strand | 71-75 | 5 | 14 |
| β-strand | 81-85 | 5 | 14 |
| β-strand | 91-95 | 5 | 14 |
| β-strand | 111-118 | 8 | 15 |
| β-strand | 121-126 | 6 | 15 |
| β-strand | 130-135 | 6 | 15 |
| β-strand | 141-146 | 6 | 15 |
| α-helix | 154-155 | 2 | |
| β-strand | 156-158 | 3 | 16 |
| β-strand | 161-165 | 5 | 16 |
| β-strand | 170-175 | 6 | 16 |
| β-strand | 181-186 | 6 | 16 |
| β-strand | 193 | 1 | 4 |
| β-strand | 201-203 | 3 | 17 |
| β-strand | 206-209 | 4 | 17 |
| β-strand | 211 | 1 | 18 |
| β-strand | 215-220 | 6 | 17 |
| β-strand | 225-231 | 7 | 17 |
| α-helix | 241-243 | 3 | |
| β-strand | 247 | 1 | 18 |
| α-helix | 250-251 | 2 | |
| β-strand | 252-254 | 3 | 19 |
| β-strand | 257-260 | 4 | 19 |
| β-strand | 267-271 | 5 | 19 |
| β-strand | 277-281 | 5 | 19 |
| β-strand | 287-292 | 6 | 20 |
| β-strand | 295-299 | 5 | 20 |
| β-strand | 305-309 | 5 | 20 |
| β-strand | 315-319 | 5 | 20 |
| β-strand | 331-333 | 3 | 21 |
| β-strand | 336-340 | 5 | 21 |
| β-strand | 346-350 | 5 | 21 |
| β-strand | 356-359 | 4 | 21 |
| β-strand | 367 | 1 | 22 |
| α-helix | 370-371 | 2 | |
| β-strand | 372 | 1 | 13 |
| β-strand | 379-381 | 3 | 13 |
| β-strand | 382 | 1 | 22 |
| β-strand | 386-391 | 6 | 13 |
Chain C: 8 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 30-32 | 3 | |
| α-helix | 34-36 | 3 | |
| α-helix | 40-43 | 4 | |
| α-helix | 45-47 | 3 | |
| α-helix | 52-53 | 2 | |
| α-helix | 58-61 | 4 | |
| α-helix | 77-79 | 3 | |
| α-helix | 84-85 | 2 | |
Chain D: 10 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 32-45 | 14 | |
| α-helix | 48-61 | 14 | |
| α-helix | 68-81 | 14 | |
| α-helix | 85-98 | 14 | |
| α-helix | 105-120 | 16 | |
| β-strand | 124 | 1 | 23 |
| β-strand | 127 | 1 | 23 |
| α-helix | 138-153 | 16 | |
| α-helix | 160-188 | 29 | |
| α-helix | 191-204 | 14 | |
| α-helix | 211-224 | 14 | |
| α-helix | 228-241 | 14 | |
Chain E: 2 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 32-35 | 4 | 24 |
| α-helix | 40-43 | 4 | |
| β-strand | 51 | 1 | 24 |
| α-helix | 52-59 | 8 | |
| β-strand | 65 | 1 | 24 |
| β-strand | 73-80 | 8 | 24 |
| β-strand | 87-96 | 10 | 24 |
| β-strand | 100-107 | 8 | 24 |
Chain F: 1 helix, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 611-620 | 10 | 7 |
| β-strand | 628-637 | 10 | 7 |
| β-strand | 710-720 | 11 | 7 |
| α-helix | 727-730 | 4 | |
| β-strand | 734-744 | 11 | 7 |
| β-strand | 766-777 | 12 | 7 |
| β-strand | 782-788 | 7 | 7 |
| β-strand | 799-809 | 11 | 7 |
Chain G: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-7 | 6 | 7 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Outer membrane protein assembly factor BamA | A | protein | 790 | Escherichia coli K-12 | P0A940 (AlphaFold model) |
| Outer membrane protein assembly factor BamB | B | protein | 373 | Escherichia coli K-12 | P77774 (AlphaFold model) |
| Outer membrane protein assembly factor BamC | C | protein | 320 | Escherichia coli K-12 | P0A903 (AlphaFold model) |
| Outer membrane protein assembly factor BamD | D | protein | 226 | Escherichia coli K-12 | P0AC02 (AlphaFold model) |
| Outer membrane protein assembly factor BamE | E | protein | 104 | Escherichia coli K-12 | P0A937 |
| Outer membrane protein assembly factor BamA | F | protein | 568 | Escherichia coli K-12 | P0A940 (AlphaFold model) |
| Unknown peptide | G | protein | 8 | Escherichia coli K-12 | |
Sequence of entity 1 (A), FASTA
>9MGF_1 Outer membrane protein assembly factor BamA (chains A)
AEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRD
GDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDF
YYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLR
DEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNI
TEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYP
RVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSD
LVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSF
QAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDAD
LSDYTNKSYGTCVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSD
QDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVP
IDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQAS
NYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWD
MGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAE
QFQFNIGKTW
Sequence of entity 2 (B), FASTA
>9MGF_2 Outer membrane protein assembly factor BamB (chains B)
CSLFNSEEDVVKMSPLPTVENQFTPTTAWSTSVGSGIGNFYSNLHPALADNVVYAADRAG
LVKALNADDGKEIWSVSLAEKDGWFSKEPALLSGGVTVSGGHVYIGSEKAQVYALNTSDG
TVAWQTKVAGEALSRPVVSDGLVLIHTSNGQLQALNEADGAVKWTVNLDMPSLSLRGESA
PTTAFGAAVVGGDNGRVSAVLMEQGQMIWQQRISQATGSTEIDRLSDVDTTPVVVNGVVF
ALAYNGNLTALDLRSGQIMWKRELGSVNDFIVDGNRIYLVDQNDRVMALTIDGGVTLWTQ
SDLLHRLLTSPVLYNGNLVVGDSEGYLHWINVEDGRFVAQQKVDSSGFQTEPVAADGKLL
IQAKDGTVYSITR
Sequence of entity 3 (C), FASTA
>9MGF_3 Outer membrane protein assembly factor BamC (chains C)
CSSDSRYKRQVSGDEAYLEAAPLAELHAPAGMILPVTSGDYAIPVTNGSGAVGKALDIRP
PAQPLALVSGARTQFTGDTASLLVENGRGNTLWPQVVSVLQAKNYTITQRDDAGQTLTTD
WVQWNRLDEDEQYRGRYQISVKPQGYQQAVTVKLLNLEQAGKPVADAASMQRYSTEMMNV
ISAGLDKSATDAANAAQNRASTTMDVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKVGM
KVTDSTRSQGNMAVTYKPLSDSDWQELGASDPGLASGDYKLQVGDLDNRSSLQFIDPKGH
TLTQSQNDALVAVFQAAFSK
Sequence of entity 4 (D), FASTA
>9MGF_4 Outer membrane protein assembly factor BamD (chains D)
CSGSKEEVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAY
YKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSALQGFFGVDRSDRDPQH
ARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVE
GMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSSNT
Sequence of entity 5 (E), FASTA
>9MGF_5 Outer membrane protein assembly factor BamE (chains E)
CSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQ
QPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGNGGHHHHHHHH
Sequence of entity 6 (F), FASTA
>9MGF_6 Outer membrane protein assembly factor BamA (chains F)
AWSHPQFEKGGGSGGGSGGSAWSHPQFEKEGFVVKDIHFEGLQRVAVGAALLSMPVRTGD
TVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQ
NLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEN
TGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDG
VSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQ
VAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTCKVTIP
GSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRG
FQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPT
PFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGP
LVFSYAQPFKKYDGDKAEQFQFNIGKTW
Sequence of entity 7 (G), FASTA
>9MGF_7 Unknown peptide (chains G)
XXXXXXXX
Primary citation
Structures of folding intermediates on BAM show diverse substrates fold by a conserved mechanism. Thomson, B.D., Marquez, M.D., Rawson, S. et al. Proc Natl Acad Sci U S A (2026) 123:e2534936123-e2534936123. DOI 10.1073/pnas.2534936123 · PubMed
Other PDB entries of the same protein (UniProt P0A940 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3Q6B 1.5 Å, The high-resolution and new form crystal structure of BamA POTRA4-5 from E.coli
- 9CS2 1.78 Å, E. coli BamA beta-barrel bound to cyclic peptide CP3
- 6QGW 1.94 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody E6
- 9CS0 1.94 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP1
- 9CS1 2.15 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP2
- 4XGA 2.15 Å, Crystal structure of BamB and BamA P3-5 complex from E.coli
- 2QDF 2.2 Å, Structure of N-terminal domain of E. Coli YaeT
- 6QGX 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody F7
- 7NRF 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 2)
- 7NRE 2.3 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 1)
- 7P1C 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin B
- 7R1V 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with dynobactin A
Browse structure collections
About this viewer
MolViewer shows 9MGF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.