9QD4: Neurotensin receptor 1

Crystal structure of the neurotensin receptor 1 in complex with the small-molecule full agonist cp30a. Determined by X-ray diffraction at 3.11 Å resolution. Released 11 Feb 2026.

Method: X-ray diffraction
Resolution: 3.11 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 3,339
Mol. weight: 55.49 kDa
Ligands: A1I5W
Released: 11 Feb 2026

Explore 9QD4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9QD4 contains 25 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	61-91	31
α-helix	97-115	19
α-helix	116-120	5
α-helix	121-124	4
α-helix	125-130	6
α-helix	138-172	35
α-helix	174-180	7
α-helix	183-200	18
α-helix	203-207	5
β-strand	208-212	5	1
α-helix	220-222	3
β-strand	223-227	5	1
α-helix	231-242	12
α-helix	243-247	5
α-helix	248-266	19
α-helix	297-333	37
α-helix	341-363	23
α-helix	367-391	25
α-helix	394-402	9
α-helix	417-424	8
α-helix	427-435	9
α-helix	450-457	8
α-helix	460-468	9
α-helix	483-489	7
α-helix	493-501	9
α-helix	516-523	8
α-helix	526-541	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurotensin receptor type 1, DARPin fusion	A	protein	500	Rattus norvegicus	P20789 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9QD4_1 Neurotensin receptor type 1, DARPin fusion (chains A)
GPGSGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNGVTLFTLARKKSLQSLQSRVDYY
LGSLALSDLLILLFALPVDLYNFIWVHHPWAFGDAGCKGYYFLREACTYATALNVVSLSV
ELYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNLSGDGTHPGGLVC
TPIVDTATLRVVIQLNTFMSFLFPMLVASILNTVAARRLTVMVHQAAEQGRVCTVGTHNG
LEHSTFNMTIEPGRVQALRRGVLVLRAVVIAFVVCWLPYHVRRLMFVYISDEQWTTALFD
FYHYFYMLSNALVYVSAAINPILYNLAEDLVEDWEKARKLLEAARKGQDDEVRILLANGA
DVNTADETGFTPLHLAAWEGHLGIVEVLLKNGADVNANDERGHTPLHLAAYTGHLEIVEV
LLKNGAGVNATDVIGTAPLHLAAMWGHLEIVEVLLKNGADVNAQDKFGKTPFDLAIDNGN
EDIAEVLQKAATRELEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
A1I5W	(2~{S})-4-methyl-2-[[3-[5-(2-methylphenyl)-1,2,3,4-tetrazol-1-yl]-5-(5-methylth…	C26 H27 N5 O3 S	1

Primary citation

Docking of virtual libraries identifies small-molecule agonists of neurotensin receptors with analgesic activity. Panel, N., Vo, D.D., Hubner, H. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-74990-1 · PubMed

Other PDB entries of the same protein (UniProt P20789 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YVR 2.46 Å, Crystal structure of the neurotensin receptor 1 in complex with the peptide full agonist…
8FMZ 2.59 Å, Neurotensin receptor allosterism revealed in complex with a biased allosteric modulator
6Z4V 2.6 Å, Crystal structure of the neurotensin receptor 1 (NTSR1-H4bmx) in complex with NTS8-13
4XES 2.6 Å, Structure of active-like neurotensin receptor
6ZIN 2.64 Å, Crystal structure of the neurotensin receptor 1 in complex with the small molecule…
6Z4S 2.71 Å, Crystal structure of the neurotensin receptor 1 (NTSR1-H4bmx) in complex with the small…
6ZA8 2.72 Å, Crystal structure of the neurotensin receptor 1 in complex with the small-molecule…
4BUO 2.75 Å, High Resolution Structure of Thermostable Agonist-bound Neurotensin Receptor 1 Mutant…
4GRV 2.8 Å, The crystal structure of the neurotensin receptor NTS1 in complex with neurotensin (8-13)
6Z8N 2.8 Å, Crystal structure of the neurotensin receptor 1 in complex with the small-molecule full…
8FN1 2.88 Å, CryoEM structure of Go-coupled NTSR1
8FN0 2.89 Å, CryoEM structure of Go-coupled NTSR1 with a biased allosteric modulator

Browse structure collections

About this viewer

MolViewer shows 9QD4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.