9QJX: GABA-A receptor a2b3g2 + a2NB00(PAM) + GABA

GABA-A receptor a2b3g2 + a2NB00(PAM) + GABA. Determined by electron microscopy at 2.7 Å resolution. Released 26 Aug 2026.

Method: Electron microscopy
Resolution: 2.7 Å
Organisms: Homo sapiens, Escherichia coli, Lama glama
Chains: 7
Atoms: 15,733
Mol. weight: 261.75 kDa
Ligands: ABU, NAG
Released: 26 Aug 2026

Explore 9QJX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9QJX contains 64 α-helices and 100 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	12-21	10
β-strand	38-48	11	1
β-strand	49	1	2
β-strand	52-53	2	1
β-strand	58-70	13	1
α-helix	72-74	3
β-strand	82-85	4	1
α-helix	87-91	5
β-strand	98-100	3	3
β-strand	103	1	1
β-strand	107-108	2	1
β-strand	112	1	4
β-strand	116	1	1
β-strand	118-121	4	1
β-strand	125-127	3	1
β-strand	130-137	8	1
α-helix	142-144	3
β-strand	149-158	10	3
β-strand	166-170	5	1
α-helix	175-177	3
β-strand	178-180	3	1
β-strand	185	1	2
β-strand	190-203	14	3
β-strand	208-220	13	3
α-helix	224-227	4
α-helix	230-242	13
α-helix	243-245	3
α-helix	251-273	23
α-helix	284-312	29
α-helix	314-411	29

Chain B: 11 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	9-19	11
α-helix	35	1
β-strand	36-51	16	5
β-strand	56-68	13	5
α-helix	70-72	3
β-strand	82-83	2	5
α-helix	85-90	6
β-strand	96-98	3	4
β-strand	101-106	6	5
β-strand	110	1	6
β-strand	114-118	5	5
β-strand	123-135	13	5
β-strand	147-156	10	4
β-strand	164-168	5	5
α-helix	171-173	3
β-strand	175-176	2	5
β-strand	186-200	15	4
β-strand	203-216	14	4
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-238	12
α-helix	247-269	23
α-helix	280-306	27
α-helix	423-446	24

Chain C: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	26-35	10
α-helix	50	1
β-strand	51-66	16	7
β-strand	71-83	13	7
α-helix	85-87	3
β-strand	95-98	4	7
α-helix	102-105	4
β-strand	111-113	3	6
β-strand	116-121	6	7
β-strand	129-134	6	7
β-strand	138-150	13	7
β-strand	162-171	10	6
β-strand	179-188	10	7
β-strand	201-214	14	6
β-strand	219-231	13	6
α-helix	234-236	3
α-helix	237-241	5
α-helix	242-256	15
α-helix	262-286	25
α-helix	295-321	27
α-helix	410-432	23

Chain D: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	11-21	11
β-strand	38-48	11	8
β-strand	49	1	9
β-strand	52-53	2	10
β-strand	58-59	2	10
β-strand	61-69	9	8
α-helix	72-74	3
β-strand	82-85	4	8
α-helix	87-92	6
β-strand	98-100	3	11
β-strand	103	1	12
β-strand	107-108	2	8
β-strand	116-121	6	8
β-strand	126-134	9	8
β-strand	136	1	12
β-strand	137	1	10
α-helix	142-144	3
β-strand	149-158	10	11
β-strand	166-170	5	8
β-strand	178-180	3	8
β-strand	185	1	9
β-strand	190-203	14	11
β-strand	208-220	13	11
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-242	12
α-helix	243-245	3
α-helix	251-273	23
α-helix	284-310	27
α-helix	314-412	30

Chain E: 13 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	9-20	12
α-helix	35	1
β-strand	36-51	16	13
β-strand	56-68	13	13
α-helix	70-72	3
β-strand	82-83	2	13
α-helix	85-90	6
β-strand	96-98	3	14
β-strand	101-106	6	13
β-strand	110	1	3
β-strand	114-118	5	13
β-strand	123-135	13	13
β-strand	147-156	10	14
β-strand	164-168	5	13
α-helix	171-173	3
β-strand	175-176	2	13
β-strand	186-200	15	14
β-strand	203-216	14	14
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-236	10
α-helix	238-241	4
α-helix	247-269	23
α-helix	278-279	2
α-helix	280-306	27
α-helix	420-445	26

Chain F: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	15
β-strand	11-13	3	16
β-strand	17-23	7	15
α-helix	29-31	3
β-strand	33-39	7	17
β-strand	46-51	6	17
α-helix	53-55	3
β-strand	58-60	3	17
α-helix	62-64	3
β-strand	69-73	5	15
β-strand	78-84	7	15
α-helix	88-90	3
β-strand	92-99	8	17
α-helix	107-109	3
β-strand	112-113	2	17
β-strand	117-119	3	17
β-strand	120-122	3	16

Chain G: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	18
β-strand	11-13	3	19
β-strand	17-20	4	18
β-strand	23	1	18
α-helix	29-31	3
β-strand	33-39	7	20
β-strand	46-51	6	20
β-strand	58-60	3	20
β-strand	68-73	6	18
β-strand	78-84	7	18
α-helix	88-90	3
β-strand	92-99	8	20
α-helix	107-109	3
β-strand	112-113	2	20
β-strand	117-119	3	20
β-strand	120-122	3	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit alpha-2	A, D	protein	354	Homo sapiens	P47869 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-3,Soluble cytochrome b562	B, E	protein	451	Homo sapiens, Escherichia coli	P0ABE7 (AlphaFold model), P28472 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	C	protein	371	Homo sapiens	P18507 (AlphaFold model)
a2NB00	F, G	protein	133	Lama glama

Sequence of entity 1 (A, D), FASTA

>9QJX_1 Gamma-aminobutyric acid receptor subunit alpha-2 (chains A, D)
NIQEDEAKNNITIFTRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYT
IDVFFRQKWKDERLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRI
QDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQV
APDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILS
QVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSAL
IEFATVNYFTKSQPARAAKIDRMSRIVFPVLFGTFNLVYWATYLNREPVLGVSP

Sequence of entity 2 (B, E), FASTA

>9QJX_2 Gamma-aminobutyric acid receptor subunit beta-3,Soluble cytochrome b562 (chains B, E)
QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLT
MYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVER
IELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYA
FVNYIFFSQPAGTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPK
LEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLT
GRAAAIDRWSRIVFPFTFSLFNLVYWLYYVN

Sequence of entity 3 (C), FASTA

>9QJX_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains C)
QKSDDDYEDYTSNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVN
SIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKAD
AHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIV
YQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQT
YIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV
SVCFIFVFSALVEYGTLHYFVSSQPARAAKMDSYARIFFPTAFCLFNLVYWVSYLYLGTG
TGTETSQVAPA

Sequence of entity 4 (F, G), FASTA

>9QJX_4 a2NB00 (chains F, G)
QVQLVESGGALVQAGGSLRLSCAASGFTFDDYAIGWFRRAPGKEREGVSCISSGGGSTYY
ADSVKGRFTISSDNAKNTVYLQMNSLKPEDTAVYFCAAVGYSSSCNPLWYDYWGQGTQVT
VSSHHHHHHEPEA

Ligands and cofactors

ID	Name	Formula	Copies
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Determining the molecular and physiological actions of subtype-selective nanobodies of GABA A receptors. Gonzalez-Prada, J.E., Liu, S., Shang, C. et al. Sci Adv (2026) 12:eaeg3548-eaeg3548. DOI 10.1126/sciadv.aeg3548 · PubMed

Other PDB entries of the same protein (UniProt P47869 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QJS 2.52 Å, GABA-A receptor a2b3 (1:4) + a2NB16(silent) + b3Mb125 + GABA
9QJY 2.78 Å, GABA-A receptor a2b3g2 + a2NB04(silent) + GABA
9QJR 2.92 Å, GABA-A receptor a2b3 (1:4) + a2NB29(near-silent) + b3Mb125 + GABA
9QK0 3.01 Å, GABA-A receptor a2b3g2 + a2NB25(inhibitor)
9QK1 3.05 Å, GABA-A receptor a2b3 (1:4) + a2NB06(silent) + b3Mb125 + GABA
9CRV 3.18 Å, Native human GABAA receptor of beta2-alpha1-gamma2-beta2-alpha2 assembly
9CT0 3.19 Å, Native human GABAA receptor of beta2-alpha1-beta2-alpha2-gamma2 assembly
9CX7 3.3 Å, Native human GABAA receptor of beta3-alpha1-gamma2-beta3-alpha2 assembly
9CXC 3.3 Å, Native human GABAA receptor of beta3-alpha1-gamma2-beta2-alpha2 assembly
9CXB 3.33 Å, Native human GABAA receptor of beta2-alpha1-beta1-alpha2-gamma2 assembly
9CSB 3.34 Å, Native human GABAA receptor of beta3-alpha1-beta2-alpha2-gamma2 assembly
9CTV 3.36 Å, Native human GABAA receptor of beta2-alpha1-gamma2-beta1-alpha2 assembly

Browse structure collections

About this viewer

MolViewer shows 9QJX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.